BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00368 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 3.2 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 3.2 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 4.3 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 24 4.3 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 24 5.6 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 24 5.6 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.8 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 9.8 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 540 IHRKHTKMLLKSARRK-CSPH 599 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 540 IHRKHTKMLLKSARRK-CSPH 599 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 4.3 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +3 Query: 285 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKV 458 W+V+ ++ + K + + +V K C V L+D LI K NP+ V Sbjct: 274 WKVMKDVKDFIKLLLHKAFIVENQPPQVMKMNTRFCASVRLLIDNALIMKIGNPKVTV 331 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 24.2 bits (50), Expect = 4.3 Identities = 21/78 (26%), Positives = 29/78 (37%) Frame = +2 Query: 98 RPRCPSTRKNWCNVPNWPNKLSDMTTWXXXXXXXXXXASNLATRRGTSFQLLKECRRCPT 277 RPR PS R N N+P P+ S+ + S+ T T + L CP Sbjct: 126 RPRTPSMRVNCTNIP--PDTSSEEISSEMSAALGVEIFSDQITTVKTHYGTLVAFFDCPA 183 Query: 278 VIMACHFLN*TENRGFRK 331 + + L GF K Sbjct: 184 ITVTDQALARQYTVGFSK 201 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +3 Query: 174 HGGRDEGSDGNRRRT*QRGEEPPFSC 251 HGG D D + EE PF C Sbjct: 222 HGGDDSDGDDTKYEIHSDDEELPFKC 247 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +3 Query: 174 HGGRDEGSDGNRRRT*QRGEEPPFSC 251 HGG D D + EE PF C Sbjct: 222 HGGDDSDGDDTKYEIHSDDEELPFKC 247 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 222 QRGEEPPFSCLKNVVGARRSSWRVISSIEQKT 317 ++GEE S K V R SW + +I T Sbjct: 1420 EKGEEKKISLRKAEVKQRIGSWNYVETIVDTT 1451 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 306 EQKTEGSERKQQMAKEYRVKVEKELRE 386 EQ+ K+Q KE R K E+E ++ Sbjct: 476 EQREREQREKEQREKEQREKEERERQQ 502 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 91 LPSSTMS-VDKEELVQRAKLAEQAERYDDMAAA 186 LP T + D E+++ +QAE Y DM+ A Sbjct: 649 LPLRTQNKTDAEKILSHVHALKQAEGYIDMSCA 681 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,929 Number of Sequences: 2352 Number of extensions: 16364 Number of successful extensions: 37 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -