BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00366 (425 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 3.3 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 22 3.3 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 3.3 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 3.3 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 4.4 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 4.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 4.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 4.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 4.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 4.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 5.8 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 7.6 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.6 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 222 KNRQTREHLLVSLPIKEFEII 284 KN QTREH L++ + ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 222 KNRQTREHLLVSLPIKEFEII 284 KN QTREH L++ + ++I Sbjct: 56 KNGQTREHALLAFTLGVKQLI 76 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 222 KNRQTREHLLVSLPIKEFEII 284 KN QTREH L++ + ++I Sbjct: 72 KNGQTREHALLAFTLGVKQLI 92 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 222 KNRQTREHLLVSLPIKEFEII 284 KN QTREH L++ + ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 207 SCSRRKNRQTRE 242 SCSR +NR+ RE Sbjct: 236 SCSRDRNREYRE 247 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 5.8 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -1 Query: 386 MAKMLERCAVQHVFVLYRHDL*NLIIQGRAXEXXNDLEFFDW 261 M K+ + + F++Y HD +Q + D F W Sbjct: 154 MVKLTLKLSCAMNFLIYPHDTQECKLQMESLSHTTDEMIFQW 195 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 20.6 bits (41), Expect = 7.6 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +2 Query: 218 KEKSTNSRAFTCFFTNQRIRDHXFXXRPV 304 KEK R +C +R + F RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 7.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 125 HEDRRGLYLHRVIRIR 78 HED+RG Y + IR Sbjct: 495 HEDKRGCYQLAINHIR 510 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 7.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 125 HEDRRGLYLHRVIRIR 78 HED+RG Y + IR Sbjct: 585 HEDKRGCYQLAINHIR 600 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,180 Number of Sequences: 438 Number of extensions: 2190 Number of successful extensions: 48 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10997463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -