BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00362 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_38171| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_26755| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_57195| Best HMM Match : UPF0126 (HMM E-Value=1.8) 29 2.6 SB_59351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) 28 6.0 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1139| Best HMM Match : wnt (HMM E-Value=0) 28 6.0 >SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 71.3 bits (167), Expect = 6e-13 Identities = 35/75 (46%), Positives = 43/75 (57%) Frame = +2 Query: 32 FIILAGISTGIYFLFLCYMIWQVFINISHKRQSLPTMCSVRRLHYEGIIYRFKFXXXXXX 211 FII AGI +YFLFLC M+ +VF NI KR + M RRLHYEG+IYRF+F Sbjct: 306 FIICAGICACVYFLFLCVMVIKVFWNIRGKRATFAKMSRARRLHYEGLIYRFEFLMVITL 365 Query: 212 XXXXXXIIGFTLGQV 256 +I F + V Sbjct: 366 LCAALTVIFFVISNV 380 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 4/80 (5%) Frame = +1 Query: 208 IAVCCTDYNRIY--IGTSAEGQWKW-DENIELEYTSAFFTGVYGMWNIYIFALLVLYAPS 378 I + C I+ I E QWK+ E +E +SA FTG+YGMWN Y+ L+ LYAPS Sbjct: 363 ITLLCAALTVIFFVISNVNEAQWKFGSEESTVEISSALFTGIYGMWNTYVLTLMYLYAPS 422 Query: 379 HKQWPA-VEDTSDTQNLSEE 435 + A ++ DT L+ E Sbjct: 423 TGDFAAGYNESRDTVELTGE 442 >SB_38171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 36.7 bits (81), Expect = 0.017 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 307 AFFTGVYGMWNIYIFALLVLYAP 375 A TG+YGMWN Y+ L+ LY P Sbjct: 2 ALDTGIYGMWNTYVLTLMYLYEP 24 >SB_26755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1607 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 199 AGYIAVCCTDYNRIYIGT-SAEGQWK--WDENIELEYTSAFFTGV 324 AG++ + D NR Y+G SAE W+ DE +++ F G+ Sbjct: 1000 AGFVMIGSPDLNRKYVGVDSAEVHWRNFRDEESGIDFCDVFIDGL 1044 >SB_57195| Best HMM Match : UPF0126 (HMM E-Value=1.8) Length = 1699 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 199 AGYIAVCCTDYNRIYIGT-SAEGQWK--WDENIELEYTSAFFTGV 324 AG++ + D NR Y+G SAE W+ DE +++ F G+ Sbjct: 946 AGFVMIGSPDLNRKYVGVDSAEVHWRNFRDEESGIDFCDVFIDGL 990 >SB_59351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -3 Query: 462 PLLQWSKFNF---LAQILCIRCILNGWPLLVTRSIQ-NQQCKY 346 PLL + + N LA I+C C+++G + ++ S++ QCKY Sbjct: 16 PLLVFKRTNLQRILADIMCASCLISGEMMKMSSSLRTGGQCKY 58 >SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) Length = 1297 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 125 QSLPTMCSVRRLHYEGIIYRFKF 193 +SL T+ R +HY G++YR +F Sbjct: 306 KSLQTLMDSRPVHYNGVVYRNRF 328 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 364 LYAPSHKQWPAVEDTSDTQNLSEEIEFTPLQE 459 +Y P +KQW D+ QN + + P Q+ Sbjct: 1244 MYCPQYKQWGRCSDSWTRQNCQKSCDLCPQQQ 1275 >SB_1139| Best HMM Match : wnt (HMM E-Value=0) Length = 500 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 494 RNEVRDEISLDRSCNGVNSISSLKFCVSDVSS 399 R V+ +SLD C+GV+ S++ C +SS Sbjct: 330 RRVVKTNMSLDCKCHGVSGSCSVRTCWKSISS 361 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,352,911 Number of Sequences: 59808 Number of extensions: 398122 Number of successful extensions: 996 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -