BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00362 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04390.1 68417.m00627 Ulp1 protease family protein contains P... 29 3.7 At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.7 At5g53620.2 68418.m06662 expressed protein 28 6.5 At5g53620.1 68418.m06661 expressed protein 28 6.5 At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase fa... 28 6.5 At5g04500.1 68418.m00449 glycosyltransferase family protein 47 l... 28 6.5 At1g23360.3 68414.m02922 UbiE/COQ5 methyltransferase family prot... 28 6.5 At1g23360.2 68414.m02921 UbiE/COQ5 methyltransferase family prot... 28 6.5 At1g23360.1 68414.m02923 UbiE/COQ5 methyltransferase family prot... 28 6.5 >At4g04390.1 68417.m00627 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 963 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 289 ELEYTSAFFTGVYGMWNIYIFALLVLYA-PSHKQWPAVEDTSDTQNLSEEIEFTPLQ 456 E+E + V G+ +Y L+VL A P+ K+ P EDT +++ E +E P Q Sbjct: 217 EVEQLATTSVDVQGL--LYALQLVVLQAAPAIKEGPVSEDTVCSESDEETLELIPRQ 271 >At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 406 YPQRLAIACDSEHTKPTMQICRCSTFHKLQ*KMLKY 299 YP L I D + I C+TF KL+ K+LK+ Sbjct: 184 YPNILRIVVDQLSNIDRVDIVLCNTFDKLEEKLLKW 219 >At5g53620.2 68418.m06662 expressed protein Length = 682 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 370 APSHKQWPAVEDTSDTQNL--SEEIEFTPLQERS 465 APS K+W AV D+ DT + E+++ ER+ Sbjct: 23 APSRKEWRAVSDSQDTTDYVDLEQLKLNRTDERT 56 >At5g53620.1 68418.m06661 expressed protein Length = 682 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 370 APSHKQWPAVEDTSDTQNL--SEEIEFTPLQERS 465 APS K+W AV D+ DT + E+++ ER+ Sbjct: 23 APSRKEWRAVSDSQDTTDYVDLEQLKLNRTDERT 56 >At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to flavanone 3-hydroxylase [Persea americana][GI:727410]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 341 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 294 GVYFSIFHWSLWNVEHLHICIVGFVCSESQAMAS 395 GVY S++H ++ N E+ + + F+C A+ S Sbjct: 262 GVYKSVWHRAVTNTENPRLSVASFLCPADCAVMS 295 >At5g04500.1 68418.m00449 glycosyltransferase family protein 47 low similarity to Exostosin-like 2, Homo sapiens [SP|Q9UBQ6], EXTL2, Mus musculus [GI:10443633] Length = 765 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/94 (21%), Positives = 42/94 (44%) Frame = +1 Query: 208 IAVCCTDYNRIYIGTSAEGQWKWDENIELEYTSAFFTGVYGMWNIYIFALLVLYAPSHKQ 387 + + C IY G+ A + + ++ ++T A T +WN+ ++ PS K+ Sbjct: 489 LLLTCVGVRYIYGGSGAVEPYPFKGHLS-QFTLATMTYDARLWNLKMYVKRYSRCPSVKE 547 Query: 388 WPAVEDTSDTQNLSEEIEFTPLQERSSEISSLTS 489 + + +LSE P++ R + +SL + Sbjct: 548 IVVIWNKGPPPDLSELDSAVPVRIRVQKQNSLNN 581 >At1g23360.3 68414.m02922 UbiE/COQ5 methyltransferase family protein similar to 2-hexaprenyl-1,4-naphthoquinone methyltransferase GB:BAA25267 GI:2982680 from [Micrococcus luteus]; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 160 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 43 GWNIDWHLFPILVLHDLASFYQYI 114 GW ID + P+ ++DLA Y+Y+ Sbjct: 95 GWMIDNVVVPVATVYDLAKEYEYL 118 >At1g23360.2 68414.m02921 UbiE/COQ5 methyltransferase family protein similar to 2-hexaprenyl-1,4-naphthoquinone methyltransferase GB:BAA25267 GI:2982680 from [Micrococcus luteus]; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 160 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 43 GWNIDWHLFPILVLHDLASFYQYI 114 GW ID + P+ ++DLA Y+Y+ Sbjct: 95 GWMIDNVVVPVATVYDLAKEYEYL 118 >At1g23360.1 68414.m02923 UbiE/COQ5 methyltransferase family protein similar to 2-hexaprenyl-1,4-naphthoquinone methyltransferase GB:BAA25267 GI:2982680 from [Micrococcus luteus]; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 198 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 43 GWNIDWHLFPILVLHDLASFYQYI 114 GW ID + P+ ++DLA Y+Y+ Sbjct: 133 GWMIDNVVVPVATVYDLAKEYEYL 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,627,083 Number of Sequences: 28952 Number of extensions: 273757 Number of successful extensions: 661 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -