BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00361 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31F10.16 |||ChAPs family protein|Schizosaccharomyces pombe|c... 27 2.5 SPBC887.17 |||uracil permease |Schizosaccharomyces pombe|chr 2||... 27 3.4 SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr... 26 4.4 SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 26 5.9 SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ... 25 7.8 >SPBC31F10.16 |||ChAPs family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 679 Score = 27.1 bits (57), Expect = 2.5 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = -1 Query: 399 EF*TATSVSATSPLCTLGTKHRAPADIIDRAPLP-PNRVSNETMKVVVFRDDRAKRSPTY 223 +F +A + P+ T + P RA LP P E ++V ++ A+ T Sbjct: 354 DFKSALLALNSCPMYTYYERDAYPLPPSARAHLPFPVNFPKEELEV----ENNAQNGYTV 409 Query: 222 ATPLMSPYNARLESSSTGSSF 160 +T + PY ARL S S +F Sbjct: 410 STEITDPYLARLPSPSLRGTF 430 >SPBC887.17 |||uracil permease |Schizosaccharomyces pombe|chr 2|||Manual Length = 625 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 457 LSKNNAGVLRPAQRGQKLAWSKRAKAGLI 543 + K + G L PA QK AW+ R + GL+ Sbjct: 497 IDKMSRGRLVPADYNQKEAWTWRVEGGLL 525 >SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 26.2 bits (55), Expect = 4.4 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = -1 Query: 306 PLPPNRVSNETMKVVVFRDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 133 P P N+T + R K++ T+ L S RL +SS SS PA + P Sbjct: 242 PSPIEEDYNDTKARRITRKGTKKKTVTFDPSLESVPQKRLNASSNVSSNPAKKTRVSP 299 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 25.8 bits (54), Expect = 5.9 Identities = 18/70 (25%), Positives = 33/70 (47%) Frame = -1 Query: 321 IIDRAPLPPNRVSNETMKVVVFRDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPK 142 +++ +PLP + ++ V + +PT A+ L P +A L SS + +SP+ Sbjct: 598 VLNTSPLPKTPEKDRSLNVTP-----SSSTPTPASVLAPPSSASLSSSKDANRSVPESPR 652 Query: 141 PVPLAVVSLD 112 V+LD Sbjct: 653 REKKNRVTLD 662 >SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces pombe|chr 3|||Manual Length = 278 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 461 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILST 312 D + LP+ + P + K+ ++F P+HH + + ++ +P +T Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTT 198 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,931,830 Number of Sequences: 5004 Number of extensions: 62222 Number of successful extensions: 141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -