BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00361 (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 2.9 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 3.8 At3g57050.3 68416.m06352 cystathionine beta-lyase, chloroplast /... 28 5.0 At3g57050.2 68416.m06351 cystathionine beta-lyase, chloroplast /... 28 5.0 At3g57050.1 68416.m06350 cystathionine beta-lyase, chloroplast /... 28 5.0 At1g01110.1 68414.m00014 expressed protein contains Prosite PS00... 28 5.0 At3g62370.1 68416.m07006 expressed protein 28 6.7 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 8.8 At3g47910.1 68416.m05224 expressed protein low similarity to non... 27 8.8 At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /... 27 8.8 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 222 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 112 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -3 Query: 454 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 338 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At3g57050.3 68416.m06352 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 378 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -2 Query: 527 ALLLHASFCPR*AGLRTPALFFDRCTAPV---KLPAWQCPRTGSRGSFK 390 +L LH+SF P A L L V K+P W+ + +R SFK Sbjct: 4 SLSLHSSFVPSFADLSDRGLISKNSPTSVSISKVPTWEKKQISNRNSFK 52 >At3g57050.2 68416.m06351 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 449 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -2 Query: 527 ALLLHASFCPR*AGLRTPALFFDRCTAPV---KLPAWQCPRTGSRGSFK 390 +L LH+SF P A L L V K+P W+ + +R SFK Sbjct: 4 SLSLHSSFVPSFADLSDRGLISKNSPTSVSISKVPTWEKKQISNRNSFK 52 >At3g57050.1 68416.m06350 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 464 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -2 Query: 527 ALLLHASFCPR*AGLRTPALFFDRCTAPV---KLPAWQCPRTGSRGSFK 390 +L LH+SF P A L L V K+P W+ + +R SFK Sbjct: 4 SLSLHSSFVPSFADLSDRGLISKNSPTSVSISKVPTWEKKQISNRNSFK 52 >At1g01110.1 68414.m00014 expressed protein contains Prosite PS00165: Serine/threonine dehydratases pyridoxal-phosphate attachment site Length = 364 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -1 Query: 315 DRAPLPPNRVSNETMKVVVFRDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADS 148 DRA L R+S + D+ + RSP++ + S + LE S SS +S Sbjct: 291 DRAGLVKKRLSYPVPPPAEYEDNNSLRSPSFKSVAGSHFGGMLEQQSNYSSCCTES 346 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 439 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 344 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 234 SPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 127 SPT + + SP A ++ + +S P +SPK P P++ Sbjct: 41 SPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 354 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 259 T+G+ HR+ AD ++ +PLP V + + +V Sbjct: 972 TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003 >At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana] Length = 1909 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 36 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKK 167 G +P + +SD + INE+ P +AK +E + GK+ Sbjct: 70 GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,848,252 Number of Sequences: 28952 Number of extensions: 352289 Number of successful extensions: 942 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -