BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00353 (624 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0544 - 23768808-23768910,23769005-23769030,23769379-237694... 29 3.0 01_01_0860 - 6705087-6705490,6706900-6708573,6709714-6709801 28 6.9 >02_04_0544 - 23768808-23768910,23769005-23769030,23769379-23769497, 23769542-23769668,23769842-23769905,23769981-23770095, 23770867-23771101,23771196-23771382,23771948-23772305, 23772432-23772465 Length = 455 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 174 PTTPTAVKPPRVGPXTSLNHSIGSSDG-RCVQRAGT*STRAYDSRLLGIPR 25 P PT PP P T+ + + SSDG R + + S YD R L + R Sbjct: 24 PPYPTGSAPPVRLPKTACSATYFSSDGSRLLATVASASATVYDCRTLSVVR 74 >01_01_0860 - 6705087-6705490,6706900-6708573,6709714-6709801 Length = 721 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -1 Query: 462 YACAAVRVQYAAV-LIYNVSSQIQYRRDKRAREREKSDKR*KL-RTIECMHAYIYIN 298 Y +A +Q+AAV ++ V S + ++RD R S+KR KL + AY++ N Sbjct: 594 YGDSAPSLQHAAVRIVSQVCSTLTFQRDWSIIVRNHSEKRNKLDKEALADQAYVHYN 650 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,186,203 Number of Sequences: 37544 Number of extensions: 235702 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -