BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00352 (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) 83 2e-16 SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) 50 3e-06 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 41 0.001 SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) 41 0.001 SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) 40 0.002 SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 39 0.005 SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 39 0.005 SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) 35 0.064 SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_19072| Best HMM Match : RIIa (HMM E-Value=3.5e-07) 33 0.34 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) 32 0.45 SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 31 1.4 SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11960| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 2.3 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 30 2.4 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 29 3.2 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 29 4.2 SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 29 5.6 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 5.6 SB_55670| Best HMM Match : zf-C2H2 (HMM E-Value=1.6e-29) 29 5.6 SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56804| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 7.4 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) 28 7.4 SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) 28 7.4 SB_36252| Best HMM Match : IQ (HMM E-Value=2.7e-35) 28 7.4 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 28 7.4 SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079) 28 7.4 SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_5494| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_24886| Best HMM Match : Extensin_2 (HMM E-Value=0.0032) 28 9.8 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) Length = 373 Score = 83.0 bits (196), Expect = 2e-16 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 1/88 (1%) Frame = +2 Query: 515 QQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKV-VHTYEGS 691 + + +LD+MFEK+ P E +I+ GD+GDNFYVI G +DV + + VHT+ G+ Sbjct: 130 EDLDVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGT 189 Query: 692 GSFGELALMYNMPRGGICTGPDRRALWA 775 G FGELALM+N R LWA Sbjct: 190 GMFGELALMHNSLRNATIVAKTEGTLWA 217 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +2 Query: 518 QMQQVLDAMFEKRSEPGEYVIRQGDDGDN-FYVIENGVFDVLVTGDDRVEKVVHTYEGSG 694 ++ +V DA++ K + GE VIR+G++ Y IE G V V D VEK V Sbjct: 255 ELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVTVK-DGEVEKTVEF--DKN 311 Query: 695 SFGELALMYNMPR 733 FGELAL+ N PR Sbjct: 312 YFGELALVMNQPR 324 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 148 RIQVPDDLREILLEFTISYLLEQPGDVINYAVEFFTGYK 264 + +P L +L EF + + E P D++ +A ++F K Sbjct: 6 QFSIPPGLSSLLEEFVVKCIQENPEDIVEFAADYFNMLK 44 >SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 4/91 (4%) Frame = +3 Query: 261 QNNRTTTIVRGPVAGTPDESIISDEE----EPPVARFNNRRKSVFAETYDPEEDDSDEGA 428 + N+ + GP D++ DE+ EPP R+ RR+SV AE + P+ +D + Sbjct: 62 EKNKEKGVSFGPPGNDEDDTYNEDEDDEMPEPPKNRYA-RRQSVCAEPFHPDSEDEGDEQ 120 Query: 429 PAVFPKSDAQRARLAEAVRGILLFRSLTRSK 521 P V+PK+D QR RL +A++ ILLF++L + + Sbjct: 121 PIVYPKTDEQRQRLNDAIKNILLFKNLAKEQ 151 Score = 56.4 bits (130), Expect = 2e-08 Identities = 21/35 (60%), Positives = 32/35 (91%) Frame = +2 Query: 515 QQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIE 619 +Q+ +VLDAMFE++++ G+++I QGDDGDNFYVI+ Sbjct: 150 EQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVID 184 >SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) Length = 376 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 1/90 (1%) Frame = +2 Query: 509 DAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEG 688 +A Q+++V++ M E+ + EY+I++ + G + YV+E G V G V + G Sbjct: 158 EASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEG------TVLGHMG 211 Query: 689 SG-SFGELALMYNMPRGGICTGPDRRALWA 775 G +FGELA++YN R LWA Sbjct: 212 PGKAFGELAILYNCTRTASVRAQTSGKLWA 241 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +2 Query: 527 QVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENG-VFDVLVTGDD 655 ++ D + E E GEY+IRQG GD F++I++G ++V G+D Sbjct: 282 KIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNGLCLVVDGED 325 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +2 Query: 509 DAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEG 688 +A Q+++++D M+ + + +I++GD G+ Y I +G V R KV+ Sbjct: 491 EAAQVRKIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVT-----RENKVLGEMVA 545 Query: 689 SGSFGELALMYNMPRGGICT 748 FGELA++YN R T Sbjct: 546 GMVFGELAILYNCRRTATVT 565 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +2 Query: 491 TAVPFSDAQQMQQVLDAMFEKRSEP---GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV 661 T VPF + + D + + + E G+Y+ R G GD Y I+ G+ D+L Sbjct: 620 TTVPFFSGASISFITDIVTKLKFEVFLNGDYICRSGHRGDKMYFIQKGIVDILTR----- 674 Query: 662 EKVVHTYEGSGS-FGELALM 718 E + T G GS FGE+ L+ Sbjct: 675 EGALATSLGDGSHFGEICLL 694 >SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) Length = 370 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +2 Query: 509 DAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVL---VTGDDRVEKVVHT 679 D + V DA+ + + G+ V+ QG+ GD F++I G VL +D +E V Sbjct: 249 DKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVEGTAVVLQRRSANEDFIE--VSR 306 Query: 680 YEGSGSFGELALMYNMPR 733 S FGE+AL+ N PR Sbjct: 307 LGPSDYFGEIALVLNRPR 324 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +2 Query: 668 VVHTYEGSGSFGELALMYNMPRGGICTGPDRRALWA 775 +V T GSFGELAL+Y PR LWA Sbjct: 179 LVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWA 214 >SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRGGI 742 PG+++ RQG+ G Y++ G +VL D E V+ T FGE++L+ G + Sbjct: 547 PGDFICRQGEKGREMYIVNKGSLEVL----DEKETVLATLSAGSHFGEISLLNMKGIGNL 602 Query: 743 CTGPDR 760 T R Sbjct: 603 RTASVR 608 >SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) Length = 581 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = +2 Query: 503 FSDAQQ--MQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVH 676 F+D + +++++ + + PG+Y+ R+GD G Y++ +G V+ GDD + Sbjct: 455 FADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVV--GDDGTTVLAI 512 Query: 677 TYEGSGSFGELALM 718 EGS FGE++++ Sbjct: 513 LSEGS-YFGEISIL 525 >SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM 718 PG+Y+ R G+ G Y+I +G +V+V EK+V G+ FGE++L+ Sbjct: 150 PGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLL 202 >SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM 718 PG+Y+ R G+ G Y+I +G +V+V EK+V G+ FGE++L+ Sbjct: 150 PGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLL 202 >SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) Length = 279 Score = 35.1 bits (77), Expect = 0.064 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 560 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPR 733 +PG+Y++ GD G Y I G ++L + V+ T FGE+ L+Y R Sbjct: 148 KPGDYIVYAGDMGREMYCIRRGQVNILCE-----DNVIGTLGPGSFFGEIGLIYGESR 200 >SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALM 718 PG+YV R+G+ G Y++ G +V+ + K+ E FGE++++ Sbjct: 403 PGDYVCRKGEVGREMYIVNRGKLEVV---SEHGTKIYAVLEAGSYFGEISVL 451 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +1 Query: 337 KSRQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRRS 483 KS + RA ++ ++P+ +TPK ++ ++ L PSR P S +R+ Sbjct: 603 KSARTRAWSVSPRLYTPKSITPKFILSPRQTLSAPPSRPKTAPTSAQRT 651 >SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 551 KRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTG 649 +R PG+Y+I+QGD+ Y I G +VL G Sbjct: 81 RRHLPGQYLIKQGDEVKKLYFIAKGFVEVLKDG 113 >SB_19072| Best HMM Match : RIIa (HMM E-Value=3.5e-07) Length = 74 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 154 QVPDDLREILLEFTISYLLEQPGDVINYAVEFFTGYKT 267 +VP L ++L F ++ L E+P DV+ + +FF T Sbjct: 7 EVPQGLEDLLEAFILTVLKEKPEDVVKFGSQFFASANT 44 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 366 RRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRS 506 RR SV E Y+P + A +PKS+ R RL + I +F+S Sbjct: 291 RRDSVAGEVYEPVNSNC-VSAQRFYPKSEDARKRLENVIGNIFIFKS 336 >SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) Length = 1344 Score = 32.3 bits (70), Expect = 0.45 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSG-SFGE-LALMYNMPRG 736 PG+++I QGD+ + Y + G +VL DD + ++ G G SFGE L N P G Sbjct: 1004 PGDFIIYQGDEISHLYFLVRGTVEVL--KDDTIMAIL----GKGDSFGENFGLSPNRPPG 1057 >SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTG 649 PG Y+I++GD+ Y + G DV+ +G Sbjct: 50 PGHYIIKEGDEVKYLYFVVEGTVDVIKSG 78 >SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 31.1 bits (67), Expect = 1.0 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 14/72 (19%) Frame = +2 Query: 560 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV--------------EKVVHTYEGSGS 697 E +I+QG G +FY I +G V +DR K++ G S Sbjct: 185 EQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQSMIIAYFSKIISEMTGGDS 244 Query: 698 FGELALMYNMPR 733 FGELALM+++ R Sbjct: 245 FGELALMHDIRR 256 >SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 355 ALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSL 474 ALT + PFSP + P + LT P SP++ P SL Sbjct: 61 ALTAYSRPFSPDSLFPPPLALTAYSRPFSPAKLIARPFSL 100 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 30.7 bits (66), Expect = 1.4 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = +2 Query: 563 PGEYVIRQGDDGDNFYVIENGVFDVLVTG 649 PG +++ +GD+ D ++I+ G +++V G Sbjct: 503 PGHFIMYEGDEVDTLHLIKRGKIEIIVNG 531 >SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +2 Query: 566 GEYVIRQGDDGDNFYVIENGVFDVLVTGD-DRVEKVV 673 GEY+IR+GD G +++ G ++ + D +++E++V Sbjct: 212 GEYIIRKGDIGQQLIILKRGTAAIVKSEDPEKLEEMV 248 >SB_11960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 24.2 bits (50), Expect(2) = 2.3 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 705 SPNEPE-PSYVWTTFSTRSSPVTRTSKTPFS 616 +PN P+ PS+ W + S R +P S Sbjct: 250 NPNNPDQPSFAWPAYDAGSQHYLRLKPSPSS 280 Score = 24.2 bits (50), Expect(2) = 2.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 513 ASENGTAVCPGPPQRDGLSVRPTW 442 ASE T V P P R G + TW Sbjct: 301 ASERSTVVPPACPPRSGATHDDTW 324 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.9 bits (64), Expect = 2.4 Identities = 24/89 (26%), Positives = 35/89 (39%), Gaps = 1/89 (1%) Frame = -2 Query: 708 SSPNEPEPSYVWTTFSTRSSPVT-RTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASR 532 S+P+ P T ST S+P T T TP + +PS+PC + +P + + S Sbjct: 19 STPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTPCTHS-TPSAPSTPSTPST 77 Query: 531 TCCICCASENGTAVCPGPPQRDGLSVRPT 445 C S T P P P+ Sbjct: 78 PCTPSTPSTPSTPSTPSTPSTPSAPSTPS 106 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +2 Query: 575 VIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRGGICTG 751 ++RQG+ G+ FY+I G V D E H + S E L++ + G Sbjct: 811 IMRQGEKGNCFYIILKGSVSVYAKQDGDGEAATHHEQSVRSHKERLLLFGAELSSLRAG 869 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -2 Query: 735 PRGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLS--PSSPCLITYSPG 562 P G + + ++P + + + ++ P R ++TP S S PSSPC + S Sbjct: 890 PSGRVSLTKNAPKSVQTTSKRPQDNLKNFPSPRKTRTPSSHQSPQSAPPSSPCTPSSSTA 949 Query: 561 SDLFSNIASRTCCICCASENGTAVCPGPPQRD 466 L +N S + + N + C PP D Sbjct: 950 PPLPTNPKSPSEAPSLNNPNPRSSCTTPPSSD 981 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -2 Query: 711 ASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSD 556 A S N P P TT SS T +S S T SPSS + +PG D Sbjct: 962 APSLNNPNPRSSCTT--PPSSDTTNSSSAGPSATNNASPSSSPYVASAPGKD 1011 >SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = +3 Query: 348 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFP--KSDAQRARLAE---AVRGILLFRSLT 512 V R K A+ D E D +EGAPA P K RA L E A +G + Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVKKLGSRAALRECIAAAKGKGCNNTKD 173 Query: 513 RSKCSRFWMRCSKR 554 C+R ++ C KR Sbjct: 174 CRPCARGFVLCMKR 187 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/75 (25%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = +3 Query: 231 QLRGRVLHRLQNNRTTTIVRGPVAGTPDESIISDEEEP-PVARFNNRRKSVFAETYDPEE 407 Q+ G+ Q N + + P + D++ P + S AE P E Sbjct: 237 QVSGKEKPEGQENPVDSQLSEPAEQAQESEKADDKKSTEPAEPVEQSQDSGVAEAESPAE 296 Query: 408 DDSDEGAPAVFPKSD 452 DS+EG P + P D Sbjct: 297 QDSEEGTPGMSPPVD 311 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 773 PTERGGLGPYRCRPAACCTSGPVRQTNRNLRMCGPP 666 PT GP PAA SGP + RN+R P Sbjct: 1066 PTHTPNSGPLEENPAASSPSGPPAKQRRNVRFVANP 1101 >SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +3 Query: 417 DEGAPAVFPKSDAQRARLAEAVRGILLFRSLTRSKCSRFWMRCSKRDPS 563 DE P V P DA R + I L S T S+FWM+CS R+ S Sbjct: 446 DEARP-VLP--DAPRYPPINSGDKIALKMSYTSGDLSKFWMKCSDRECS 491 >SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 724 VVHQGQFAKRTGTFVCVDHLFDAVV 650 +VH G RTGTF+ +D L D +V Sbjct: 489 LVHCGAGVGRTGTFIAIDSLMDQMV 513 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +3 Query: 417 DEGAPAVFPKSDAQRARLAEAVRGILLFRSLTRSKCSRFWMRCSKRDPS 563 DE P V P DA R + I L S T S+FWM+CS R+ S Sbjct: 36 DEARP-VLP--DAPRYPPINSGDKIALKMSYTSGDLSKFWMKCSDRECS 81 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -2 Query: 405 LRGHKSRRKRICADC*SAPLAALLRLILWTHQVCRRQDPVRWSSSCCFVTCEELD-RVVD 229 L G+ ++R I A L L L+ + + C R P ++ + CC V + +D R D Sbjct: 911 LPGNNNKRHEITA------LPFTLHLVNYEGKNCSRCPPAKYCTGCCIVGNDVIDLRWND 964 Query: 228 HVPRLLQQIT 199 H+ L +T Sbjct: 965 HIAIQLTNLT 974 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 394 MTPKRMILTKEPLPCSPSRTHRE 462 MTP R LT LPC SRT+ E Sbjct: 941 MTPSRASLTPTHLPCRDSRTNSE 963 >SB_55670| Best HMM Match : zf-C2H2 (HMM E-Value=1.6e-29) Length = 637 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 606 KLSPSSPCLITYSPGSDLFSNIASRTCCICCASENGTAVCPGPP 475 K SP+ P TY P S+ F+ I T E+ +++ PG P Sbjct: 589 KTSPNFPSASTYPPMSEWFNRIPGSTHHDHFHMESSSSLAPGQP 632 >SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 28.7 bits (61), Expect = 5.6 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = +3 Query: 348 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD--AQRARLAE---AVRGILLFRSLT 512 V R K A+ D E D +EGAPA P + RA L E A +G + Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVEKLGSRAALRECIAAAKGKGCNNTKD 173 Query: 513 RSKCSRFWMRCSKR 554 C+R ++ C KR Sbjct: 174 CRPCARGFVLCMKR 187 >SB_56804| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 345 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/86 (24%), Positives = 33/86 (38%), Gaps = 4/86 (4%) Frame = -2 Query: 705 SPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRTC 526 +PN P Y+W S + TS L+ S+P +TY + + TC Sbjct: 93 NPNHVVPYYIWQYVEILGSTASITSLCVIGYDRHLAISAP--LTYHARMTSRRALVAITC 150 Query: 525 C----ICCASENGTAVCPGPPQRDGL 460 C CCA+ + + P G+ Sbjct: 151 CWVYAACCAALSFVNISPSIQPTSGI 176 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 700 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE 605 K + FVCVDH + V DV A+L VE Sbjct: 105 KHSSQFVCVDHDAEYVPGSGADVNGALLYPVE 136 >SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) Length = 343 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 619 LDDVEVVAVIALSDYVLAGLGSLFEHRI 536 ++ V++ VIAL D V+AG +L HR+ Sbjct: 311 MEQVQLAGVIALLDVVVAGSTALIAHRL 338 >SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +2 Query: 569 EYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALM 718 +Y++ +GD G +I+ G +V +TG+D +V+ E +G+ L+ Sbjct: 816 DYILHKGDIGQQLIIIKRGTAEV-ITGED--PEVILPLEEMSFYGDRYLL 862 >SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 619 LDDVEVVAVIALSDYVLAGLGSLFEHRI 536 ++ V++ VIAL D V+AG +L HR+ Sbjct: 498 MEQVQLAGVIALLDVVVAGSTALIAHRL 525 >SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) Length = 649 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 434 RVPQVGRTESPSR*GGPGHTAVPFSDAQQMQQVLDAMFEKRSE 562 R P G ++ S PG + VPF Q+VL EK +E Sbjct: 174 RAPIYGHMDATSFTNRPGASRVPFYKTMDQQRVLQQSREKNTE 216 >SB_36252| Best HMM Match : IQ (HMM E-Value=2.7e-35) Length = 442 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 148 RIQVPDDLREILLEFTISYLLEQPGDVINYAVEFF 252 +++VP + +L L EQP D++ +A ++F Sbjct: 9 KLRVPPGFQNLLEGLAREVLREQPDDIVQFAAQYF 43 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 587 GDDGDNFYVIENGVFDV---LVTGDDRVEKVVHTYEGS 691 G DG+ + IENG DV L+ ++R+ +++ YEG+ Sbjct: 204 GRDGNKYMGIENGKADVSEKLLQENERLRELLRQYEGN 241 >SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079) Length = 689 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 312 DESIISDEEEPPVARFNNRRKSVFAETYDPEEDDSD 419 D +SDE + V N R+++ Y+ ++DDSD Sbjct: 447 DYDYVSDESDDWVPFDRNSRRNINNNNYESDDDDSD 482 >SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 667 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL 524 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL Sbjct: 40 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLL 87 >SB_5494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/86 (24%), Positives = 33/86 (38%), Gaps = 4/86 (4%) Frame = -2 Query: 705 SPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRTC 526 +PN P Y+W S + TS L+ S+P +TY + + TC Sbjct: 93 NPNHVVPYYIWQYVEILGSTASITSLCVIGYDRHLAISAP--LTYHARMTSRRALVAITC 150 Query: 525 C----ICCASENGTAVCPGPPQRDGL 460 C CCA+ + + P G+ Sbjct: 151 CWVYAACCAALSFVNISPSIQPTSGI 176 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 667 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL 524 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL Sbjct: 262 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLL 309 >SB_24886| Best HMM Match : Extensin_2 (HMM E-Value=0.0032) Length = 807 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 110 SLSRYYPSGNCRATRY 63 SLSRYYPSGN ++ Y Sbjct: 278 SLSRYYPSGNSQSRYY 293 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 774 AHRARRSGPVQMPPRGMLYIRASSPNE-PEPSYVW 673 AH S P Q PRG Y+ ASSP PSY W Sbjct: 2089 AHLLADSNPGQALPRG-AYVYASSPLPLKAPSYYW 2122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,313,803 Number of Sequences: 59808 Number of extensions: 563220 Number of successful extensions: 2089 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 1723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2061 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -