BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00350 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 4.1 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 7.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 7.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.5 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 243 FEQSPRLLAIRLNGREICNANNPQPALESPL 335 FE++ RL AIRL+G + + N ++ S L Sbjct: 522 FERNMRLEAIRLDGNFLSDINGVFTSIASLL 552 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = +2 Query: 557 PDVRPEHLLQTRPVQGRPSTEAERPVYVKPVNSANP 664 P RP H R + RPVY+ +P Sbjct: 79 PQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHP 114 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/36 (25%), Positives = 14/36 (38%) Frame = +2 Query: 557 PDVRPEHLLQTRPVQGRPSTEAERPVYVKPVNSANP 664 P RP H R + + RP+Y+ +P Sbjct: 51 PQPRPPHPRLRREAEPKAEPGNNRPIYIPQPRPPHP 86 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 766 GSGRAGVNLGLLFEALCPDSDIRLR 692 G+ RAG G + + LCP + R Sbjct: 250 GNFRAGPTPGTILKKLCPQEEACFR 274 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 766 GSGRAGVNLGLLFEALCPDSDIRLR 692 G+ RAG G + + LCP + R Sbjct: 165 GNFRAGPTPGTILKKLCPQEEACFR 189 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 766 GSGRAGVNLGLLFEALCPDSDIRLR 692 G+ RAG G + + LCP + R Sbjct: 484 GNFRAGPTPGTILKKLCPQEEACFR 508 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 129 LDRRCHNARQHELQNRKHADEDQS 200 +D + QH LQNR + ++ S Sbjct: 196 IDPELTESEQHRLQNRLYTNDSTS 219 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 129 LDRRCHNARQHELQNRKHADEDQS 200 +D + QH LQNR + ++ S Sbjct: 234 IDPELTESEQHRLQNRLYTNDSTS 257 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 9.5 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +2 Query: 482 KTANSY*K---TQDPVVRPQIPDTRTQSPDVRPEHLLQTRPVQGRPSTEAERPVYVKP 646 K NSY K T R + R++ + P H ++ PV RP+ V+P Sbjct: 284 KNENSYRKYRETSKERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFPPRPIMVRP 341 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 154 DNMNFKIESTQTKINPGPATAVRFFV 231 D++ +QT+ N GP + VRF V Sbjct: 583 DSLRGSTTDSQTEDNFGPLSNVRFAV 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,369 Number of Sequences: 438 Number of extensions: 4851 Number of successful extensions: 45 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -