BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00347 (572 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 27 2.0 SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosacc... 26 3.4 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 27.1 bits (57), Expect = 2.0 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +2 Query: 377 STRTTHSN--PCRKIYCLSVFNWRSILIVCIAISPGRRPLADP-FYI 508 S +T +N P ++ ++++ + S+L+ C ++ G RP P FY+ Sbjct: 567 SLASTSANFLPGEILFRIAIWIYASLLVTCFVLALGNRPHGSPNFYL 613 >SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 26.2 bits (55), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 443 SILIVCIA--ISPGRRPLADPFYI*PFK 520 SI+ +C A +SP RP A+PF +K Sbjct: 75 SIIAICFACLLSPSLRPYAEPFIFLSYK 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,216,274 Number of Sequences: 5004 Number of extensions: 42785 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -