BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00344 (365 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.32 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.32 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.32 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.32 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 5.2 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 5.2 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 20 6.9 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 20 6.9 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 20 6.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.32 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 10 DERGSSSDIRSSKQELNRDMKHRRRTPVTNSGESSTEGDSSHQSQRSVVYLHATT 174 DE+ S +I S + LN+ + H +T + SG S S S+ +L A T Sbjct: 1129 DEKASLINIADSLEMLNKRLDHIEKT-IDPSGHISRRRSMSASSRGDHHHLGAVT 1182 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.32 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 10 DERGSSSDIRSSKQELNRDMKHRRRTPVTNSGESSTEGDSSHQSQRSVVYLHATT 174 DE+ S +I S + LN+ + H +T + SG S S S+ +L A T Sbjct: 1129 DEKASLINIADSLEMLNKRLDHIEKT-IDPSGHISRRRSMSASSRGDHHHLGAVT 1182 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.32 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 10 DERGSSSDIRSSKQELNRDMKHRRRTPVTNSGESSTEGDSSHQSQRSVVYLHATT 174 DE+ S +I S + LN+ + H +T + SG S S S+ +L A T Sbjct: 1129 DEKASLINIADSLEMLNKRLDHIEKT-IDPSGHISRRRSMSASSRGDHHHLGAVT 1182 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.32 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 10 DERGSSSDIRSSKQELNRDMKHRRRTPVTNSGESSTEGDSSHQSQRSVVYLHATT 174 DE+ S +I S + LN+ + H +T + SG S S S+ +L A T Sbjct: 1129 DEKASLINIADSLEMLNKRLDHIEKT-IDPSGHISRRRSMSASSRGDHHHLGAVT 1182 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 1.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 193 GLEYHPLLLHVDKQRCV 143 G EYHP ++ + + +CV Sbjct: 858 GSEYHPSIVSLGEYKCV 874 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 5.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 131 VTNHNAALFIYMQQQWVIFQT 193 VT + +LFI + +W++ T Sbjct: 686 VTTYTTSLFINVPPRWILEPT 706 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.6 bits (41), Expect = 5.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +3 Query: 135 PITTQRCLSTCNNSG*YSRPRSNITQSFKR 224 P+ + S CNN+ Y N S+K+ Sbjct: 56 PLPSLFPFSPCNNTANYKSEAQNQPSSYKQ 85 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.2 bits (40), Expect = 6.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 287 DRETFCGAADLIFEE 243 D +TFCG D ++ + Sbjct: 621 DGDTFCGIKDKLYPD 635 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 20.2 bits (40), Expect = 6.9 Identities = 13/48 (27%), Positives = 18/48 (37%) Frame = +3 Query: 216 FKRRRFIYQLFKYQVRSTTKSFSIFAPWPRSIIASIRRPLCTQTKEIK 359 F+R+R +YQ K F R I LC ++IK Sbjct: 240 FERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 287 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 20.2 bits (40), Expect = 6.9 Identities = 13/48 (27%), Positives = 18/48 (37%) Frame = +3 Query: 216 FKRRRFIYQLFKYQVRSTTKSFSIFAPWPRSIIASIRRPLCTQTKEIK 359 F+R+R +YQ K F R I LC ++IK Sbjct: 242 FERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.312 0.126 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,302 Number of Sequences: 336 Number of extensions: 1376 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7510735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits)
- SilkBase 1999-2023 -