BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00343 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC582.06c |mcp6|hrs1, mug3|meiosis specific coiled-coil protei... 26 4.0 SPBC651.03c |gyp10||GTPase activating protein Gyp10|Schizosaccha... 25 7.0 >SPBC582.06c |mcp6|hrs1, mug3|meiosis specific coiled-coil protein Mcp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 327 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 240 QKRLWSSEMMTNKTTSRKKEITRP*TAP*RRWQLNYGYDYQP 365 +KRL + T + S+ +EI R P + LN + YQP Sbjct: 274 RKRLENDSSTTKQRLSKLEEIIRNRAPPSYSFSLNCSHTYQP 315 >SPBC651.03c |gyp10||GTPase activating protein Gyp10|Schizosaccharomyces pombe|chr 2|||Manual Length = 373 Score = 25.4 bits (53), Expect = 7.0 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 284 FKKERDY--PTLNSTVEEMATKLRI*LSTSPTLY 379 F + RD+ PTL+ TV+++ L + + PTLY Sbjct: 145 FYRLRDFMLPTLDGTVKQLQLILAVIKARDPTLY 178 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,126,504 Number of Sequences: 5004 Number of extensions: 34455 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -