BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00343 (642 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071345-1|AAL48967.1| 303|Drosophila melanogaster RE38146p pro... 29 7.1 AE013599-1831|AAF58288.1| 303|Drosophila melanogaster CG8323-PA... 29 7.1 >AY071345-1|AAL48967.1| 303|Drosophila melanogaster RE38146p protein. Length = 303 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = -3 Query: 331 LLYGAV*GRVISFFLEVVLFVIISELQSLFCRHNAVH*QPL*AAGTQELR*IYS 170 LL+GA+ G V+ + F+I ++LQS + AV Q + T LR IYS Sbjct: 109 LLWGAI-GGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYS 161 >AE013599-1831|AAF58288.1| 303|Drosophila melanogaster CG8323-PA protein. Length = 303 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = -3 Query: 331 LLYGAV*GRVISFFLEVVLFVIISELQSLFCRHNAVH*QPL*AAGTQELR*IYS 170 LL+GA+ G V+ + F+I ++LQS + AV Q + T LR IYS Sbjct: 109 LLWGAI-GGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYS 161 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,944,949 Number of Sequences: 53049 Number of extensions: 381158 Number of successful extensions: 625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -