BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00340 (786 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) 33 0.26 SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) 32 0.61 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 1.1 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_58773| Best HMM Match : DUF834 (HMM E-Value=0.83) 30 1.8 SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) 30 1.8 SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 30 2.4 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 30 2.4 SB_58762| Best HMM Match : VWC (HMM E-Value=2.8e-06) 29 3.2 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_51894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_32452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) 29 5.6 SB_5598| Best HMM Match : C1_1 (HMM E-Value=0.87) 29 5.6 SB_12890| Best HMM Match : A2M_recep (HMM E-Value=1.8e-25) 28 7.5 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) 28 7.5 SB_8898| Best HMM Match : WSC (HMM E-Value=6.4) 28 7.5 SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 28 9.9 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) Length = 705 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 281 RCSDSGVAECLRQDSCDQIIFTEPVRCQPGTSFQRDCNTCVCLDNGLGLCSLDAC 445 R + G +C+++ C I + + PG +DC CVC D L C+ C Sbjct: 224 RVNAVGKVQCIKRKECPCIHDAKIYK--PGDKVYKDCQLCVCKDGQLTNCTGQKC 276 >SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) Length = 338 Score = 31.9 bits (69), Expect = 0.61 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 5/91 (5%) Frame = +2 Query: 269 CHFCRCSDSGVAECLRQDSCDQIIFTEPVRCQPG-TSFQRDCNTCVCLDNGLGLCSLDAC 445 CH CS SG+ C + SC I + C+PG T +C C + G S A Sbjct: 215 CHIDECS-SGINNCHQDASCANTIGSFACTCKPGYTGDGINCADC-AMGMESGAISDSAI 272 Query: 446 RRSSTPKKFELIQGR----ECAPGSRGRTSV 526 SS +K GR PG+ R +V Sbjct: 273 TASSYLEKLRPSNGRLNDPSVFPGNTDRNTV 303 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +2 Query: 305 EC-LRQDSCDQIIFTEPVRCQPGTSFQRDC---NTCVCLDNGLGLCSLDACRRSSTP 463 EC +RQD+C +T P+ C P ++F D +TC D+ ++ C ++ P Sbjct: 44 ECQMRQDACFNKQWTTPISCDPCSNFTCDSPPYSTCKAQDDQPTCVCVEPCPKTLKP 100 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +2 Query: 305 EC-LRQDSCDQIIFTEPVRCQPGTSFQRDC---NTCVCLDNGLGLCSLDACRRSSTP 463 EC +RQD+C +T P+ C P ++F D +TC D+ ++ C ++ P Sbjct: 1018 ECQMRQDACFNKQWTTPISCDPCSNFTCDSPPYSTCKAQDDQPTCVCVEPCPKTLKP 1074 >SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2532 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = -2 Query: 599 GSIMCSVQASSLQMPYPSALHLQLLHWFDHAIPERILCPGSA-----QTSWELTIFYRHP 435 G+ +++A + +P S+L + + W +H +P +LC A ++SW ++ R P Sbjct: 2028 GNARKAIEALAPLVPEMSSLGVPICDWHEHCLPFSLLCDCLAECEDIESSWLQEVYQRLP 2087 Query: 434 RSIGPD 417 + D Sbjct: 2088 CRVAAD 2093 >SB_58773| Best HMM Match : DUF834 (HMM E-Value=0.83) Length = 248 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 750 SAFSALDQLRLLGSVIS---DAFHPSAHGFTIRSAPTRVAFIFP 628 S FS +L L GS IS +HP HG TI SA ++ FP Sbjct: 37 SRFSKKYRLLLHGSTISRLSKKYHPLLHGSTISSARNTISSSFP 80 >SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 628 WK-NECNTCWCTSDGKPMCTRMEC 696 WK ++C+TC+C +GK C C Sbjct: 358 WKPDDCSTCFCKKNGKVECAHQMC 381 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 625 MWK-NECNTCWCTSDGKPMCTRMEC 696 MW+ ++C C C SD K CT+ C Sbjct: 437 MWQQDDCTACICGSDRKLQCTKKTC 461 >SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) Length = 1189 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 691 PS*CTWVYHPKCTNTCCIHFSTSSS 617 PS C W P CT+ CC S++ Sbjct: 961 PSSCAWTCAPDCTSECCARHKVSAA 985 >SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1931 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/76 (28%), Positives = 32/76 (42%) Frame = +1 Query: 538 CNADGYGICSDEACTEHIIEPKKECAPKTMWKNECNTCWCTSDGKPMCTRMECITNNTPE 717 C D G SDE C E + +C P + + +CN C G P C + +C+ N Sbjct: 639 CECDTKGALSDE-CQE--FGGQCQCRPYVIGR-QCNRCKTGYYGFPNCKKCQCVFCN--- 691 Query: 718 KSELIQGRECAPGSTG 765 E +C P + G Sbjct: 692 --EETGACDCPPNTVG 705 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 371 TSFQRDCNTCVCLDNGLG----LCSLDACRRSSTPKKFELIQGRECAP 502 T+ + DCNTC C+ +C D C SST G C P Sbjct: 1195 TTVKEDCNTCSCVHGTRTCTKVVCGPDNCLNSSTVSNDICSMGSVCVP 1242 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 622 TMWKNECNTCWCTSDGKPMCTRMECITNNTPEKSELIQGRECAPGS 759 T K +CNTC C G CT++ C +N S + C+ GS Sbjct: 1195 TTVKEDCNTCSCV-HGTRTCTKVVCGPDNC-LNSSTVSNDICSMGS 1238 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 29.9 bits (64), Expect = 2.4 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = -2 Query: 743 SLPWISSDF--SGVLLVMHS-ILVHMGLPSEVHQHVLHSFFHIVF-GAHSFFGSIMCSVQ 576 SL W+ S +G V+ I V + +E VL +F H V AH F +M + Sbjct: 398 SLSWVVSKLKVTGPSDVISDYISVRDSIKAEQELEVLDNFHHFVSTNAHLFVAKMMPDIV 457 Query: 575 ASSLQMPYPSALHLQLL 525 +LQ P S +H Q + Sbjct: 458 QLALQQPSLSQVHTQAM 474 >SB_58762| Best HMM Match : VWC (HMM E-Value=2.8e-06) Length = 218 Score = 29.5 bits (63), Expect = 3.2 Identities = 26/102 (25%), Positives = 40/102 (39%), Gaps = 25/102 (24%) Frame = +1 Query: 523 CNSCRCNADGYGICS---------DEACTEHIIEPKKEC------------APKTMW--- 630 C C CN+ CS D AC ++++EPK+ C A + W Sbjct: 104 CQKCECNSGKASSCSIGYHCDALLDGACEKYVLEPKQCCPTCACVHNNTEMAEGSTWAFR 163 Query: 631 -KNECNTCWCTSDGKPMCTRMECITNNTPEKSELIQGRECAP 753 +C+ C C S G C+ + C +S+ I +C P Sbjct: 164 KDAKCHECTC-SRGNGKCSFVGCSCPVGHHQSDSIPEGKCCP 204 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 368 GTSFQRDCNTCVCLDNGLGLCSLDACRRSSTPKKFELI-QGRE 493 G DCN+CVC G +C+ C SS K L+ QG + Sbjct: 256 GAEIPTDCNSCVCA-CGRWVCTALDCNPSSNHVKASLVLQGEQ 297 >SB_51894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 562 CSDEACTEHIIEPKKECAPKTM---WKNECNTCWCTSDGKPMCTRMEC 696 C +C EH E + + + K + W++E T W G P+ T C Sbjct: 325 CHGPSCIEHKREARTDGSVKVVPYAWRSERETRWGCRGGNPLPTTCGC 372 >SB_32452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 680 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 638 SFFHIVFGAHSFFGSIMCSVQASSLQMPYPSALHLQLLHWFD 513 SF H+ F HS S M V S L++ H LHW D Sbjct: 235 SFMHLAFLHHSMLSSDMTMVLPSHLEV--TQGCHHTTLHWDD 274 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -3 Query: 733 GSAQTSRECY**CIPS*CTWVYHPKCTNTCCIHFSTSSSAHI 608 GSA TS +C PS C P C CC+ TS + Sbjct: 1897 GSAPTSSQC-----PSSCLLACQPSCPMECCLAAFTSKPVEV 1933 >SB_44205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 28.7 bits (61), Expect = 5.6 Identities = 23/87 (26%), Positives = 30/87 (34%) Frame = +2 Query: 173 RQTESDNNR*RVCRPRNAVGSGMPGGNQWESNCHFCRCSDSGVAECLRQDSCDQIIFTEP 352 R S N R C + S N + C R + S + S EP Sbjct: 213 RSNTSANTRANTCSNTSTYTSTNTRANTSSNTCADTRSNTSTSSYTGTNTSASYCRTPEP 272 Query: 353 VRCQPGTSFQRDCNTCVCLDNGLGLCS 433 RC P +F D C + NGL + S Sbjct: 273 -RCPPLVNFSLDLPECFAIRNGLQVVS 298 >SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) Length = 746 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -2 Query: 680 HMGLPSEVHQHVLHSFFHIVFGAHSFFGSIMCSVQ-ASSLQMPYPSALHLQLLHWFD 513 H+G+P E Q V + + + F S+ C + ASS++ PYPSA++++ L +FD Sbjct: 457 HLGIPGEFIQ-VFGDWASDAYRGYLEF-SMPCKLALASSIRTPYPSAVNVRPL-FFD 510 >SB_5598| Best HMM Match : C1_1 (HMM E-Value=0.87) Length = 296 Score = 28.7 bits (61), Expect = 5.6 Identities = 23/79 (29%), Positives = 29/79 (36%) Frame = +2 Query: 380 QRDCNTCVCLDNGLGLCSLDACRRSSTPKKFELIQGRECAPGSRGRTSVTVVGAMPMDTA 559 + + + +CLD G L CR T + L C P R R S P+ A Sbjct: 101 KEEFHCAICLDLLEGY--LVKCRACGTRLPYHLCNSHPCPPRKRQRAS------SPVPAA 152 Query: 560 FVVTKPALNTLSSQRKNVR 616 VV P TL VR Sbjct: 153 AVVLDPQTRTLEQMLNEVR 171 >SB_12890| Best HMM Match : A2M_recep (HMM E-Value=1.8e-25) Length = 203 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 667 HPKCTNTCCIHFSTSSSAHILSL-AR*CVQCRLRHYKCRIHRHCT 536 HP CTNT C S++ I R +Q + R C HR C+ Sbjct: 43 HPICTNTSCGLLRECSTSRIARFPKRDFIQNQERKTSCFNHRFCS 87 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = -3 Query: 670 YHPKCTNTCCIHFSTSSSAHILSLAR*CVQCRLRHYKCRIHRHCTYNCYTGSTTRSRS 497 Y P CT+ S+ H L + CR RH I CYT +S S Sbjct: 133 YRPCCTDLVIQTLSSYRPCHHTDLVMQTLSCRPRHTDLVIQTSSYRPCYTDLVIQSNS 190 >SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) Length = 350 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -3 Query: 580 CRLRHYKCRIHRHCT--YNCYTGSTTRSRSAF 491 C++++Y CR R C Y Y G R R + Sbjct: 128 CKVKYYHCRYRRRCVWRYKYYHGKPRRYRHCY 159 >SB_8898| Best HMM Match : WSC (HMM E-Value=6.4) Length = 165 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -3 Query: 580 CRLRHYKCRIHRHCT--YNCYTGSTTRSRSAF 491 C++++Y CR R C Y Y G R R + Sbjct: 65 CKVKYYHCRYRRRCVWRYKYYHGKPRRYRHCY 96 >SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +2 Query: 527 TVVGAMPMDTAFVVTKPALNTLSS--QRKNVRRRRCGKMNATRVGALRMV 670 +V G+ PM++ V + P++NTLS N R R + ++ + L V Sbjct: 608 SVSGSPPMESGHVQSSPSINTLSGIPDADNGRTRSASQNSSANIDLLSQV 657 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 27.9 bits (59), Expect = 9.9 Identities = 25/93 (26%), Positives = 32/93 (34%) Frame = +2 Query: 443 CRRSSTPKKFELIQGRECAPGSRGRTSVTVVGAMPMDTAFVVTKPALNTLSSQRKNVRRR 622 CR T + L C P R R + P+ A VV P TL VR Sbjct: 144 CRACGTRLPYHLCNSHPCPPRKRQRAN------SPVPAAAVVLDPQTRTLERMLNEVRTG 197 Query: 623 RCGKMNATRVGALRMVNPCALGWNASLITLPRS 721 R + R+G L + C + LP S Sbjct: 198 RVSP-DVARLGNLIVNTICKNSEDGITARLPGS 229 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.9 bits (59), Expect = 9.9 Identities = 25/93 (26%), Positives = 32/93 (34%) Frame = +2 Query: 443 CRRSSTPKKFELIQGRECAPGSRGRTSVTVVGAMPMDTAFVVTKPALNTLSSQRKNVRRR 622 CR T + L C P R R + P+ A VV P TL VR Sbjct: 242 CRACGTRLPYHLCNSHPCPPRKRQRAN------SPVPAAAVVLDPQTRTLERMLNEVRTG 295 Query: 623 RCGKMNATRVGALRMVNPCALGWNASLITLPRS 721 R + R+G L + C + LP S Sbjct: 296 RVSP-DVARLGNLIVNTICKNSEDGITARLPGS 327 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 8/53 (15%) Frame = +1 Query: 484 GQRMRSGIAWSNQ-----CNSCRCNADGYGICSDEACTEHIIEPKK---ECAP 618 GQ+ +G +W+N+ C CRC G+ C+ C+ P+ +C P Sbjct: 218 GQKYANGKSWTNKPNEDTCFQCRC-IKGFAQCTRTECSRDCPNPEPIPGQCCP 269 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,629,752 Number of Sequences: 59808 Number of extensions: 700457 Number of successful extensions: 2201 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2196 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -