BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00339 (798 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 31 1.1 SB_46027| Best HMM Match : Fibrinogen_C (HMM E-Value=0.24) 28 7.6 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = -3 Query: 193 GHYVQTHINKKEFKYIDNNSRLVNHCSQRNIHSIIGGLDYIF*QVRAGSVLRSVSWC 23 G YV THI+K E++ + S L +C+++ ++ G ++ +VR G V + C Sbjct: 530 GKYVATHISKNEWRKLVPGSSLQRNCNRQGFNNAPAGGNHS--KVRIGFVANQENNC 584 >SB_46027| Best HMM Match : Fibrinogen_C (HMM E-Value=0.24) Length = 901 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 193 GHYVQTHINKKEFKYIDNNSRLVNHCSQRNIHS 95 G YV THI+K E++ + S L +C+ + ++ Sbjct: 799 GKYVATHISKNEWRKLVPGSSLQRNCNMQGFNN 831 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,852,164 Number of Sequences: 59808 Number of extensions: 385655 Number of successful extensions: 558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -