BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00339 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83123-5|CAB05611.1| 332|Caenorhabditis elegans Hypothetical pr... 29 2.9 U23411-2|AAC46731.2| 471|Caenorhabditis elegans Hypothetical pr... 29 3.9 >Z83123-5|CAB05611.1| 332|Caenorhabditis elegans Hypothetical protein T04A11.8 protein. Length = 332 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 628 CINRPPSNLNNFKLNYFTYF*FIRVLIHCLITTISI 735 C N+PPS+L N N YF + +L L +T+ + Sbjct: 102 CYNQPPSHLLNLLFNTQAYFNYCVMLYPVLFSTVRL 137 >U23411-2|AAC46731.2| 471|Caenorhabditis elegans Hypothetical protein T25E4.2 protein. Length = 471 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 244 IKISFHRITQYISFTFLGHYVQTHINKKEFKY 149 ++I FHR+T+ +FTF GH H++ E+++ Sbjct: 409 LEIIFHRMTK--NFTFFGHSYNYHLSGFEWRF 438 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,412,740 Number of Sequences: 27780 Number of extensions: 319601 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -