BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00336 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.3 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 24 4.3 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 4.3 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.5 Identities = 18/80 (22%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +2 Query: 140 SLWFYDNDRNK--TWEENLIELTTFDTVEDFWRLYHHIKLRQNFAKVMTMQYSSKAFVLC 313 SL FY D WE+ ++ T + L + + ++ A+ + QYS+ + ++ Sbjct: 257 SLLFYKLDSKTLVAWEQYSVDFKTDEFTNLVEFLEQRVNILKSSAQNICNQYSANSIMVT 316 Query: 314 GKTMLTRWEEDGLSVLRKNN 373 G+ L V + NN Sbjct: 317 GRQARRDGRNVALPVQQTNN 336 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +3 Query: 549 KLKEQLGIHGKIGFQVHRDTMVKHSSAT 632 ++KE++G +IG+ V R+ + +H+ T Sbjct: 2912 QIKEKVGKMKQIGYHVSRNDVTQHAITT 2939 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 669 ICNAKTKQCIDSWSQNYA*PLCLCVLGNQSCR 574 IC T C DSWS + C C C+ Sbjct: 1 ICTCGTCSCFDSWSGDN----CECTTDTTGCK 28 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 669 ICNAKTKQCIDSWSQNYA*PLCLCVLGNQSCR 574 IC T C DSWS + C C C+ Sbjct: 1 ICTCGTCSCFDSWSGDN----CECTTDTTGCK 28 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 669 ICNAKTKQCIDSWSQNYA*PLCLCVLGNQSCR 574 IC T C DSWS + C C C+ Sbjct: 1 ICTCGTCSCFDSWSGDN----CECTTDTTGCK 28 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 669 ICNAKTKQCIDSWSQNYA*PLCLCVLGNQSCR 574 IC T C DSWS + C C C+ Sbjct: 1 ICTCGTCSCFDSWSGDN----CECTTDTTGCK 28 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 669 ICNAKTKQCIDSWSQNYA*PLCLCVLGNQSCR 574 IC T C DSWS + C C C+ Sbjct: 577 ICTCGTCSCFDSWSGDN----CECTTDTTGCK 604 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,683 Number of Sequences: 2352 Number of extensions: 14794 Number of successful extensions: 30 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -