BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00334 (686 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071739-1|AAL49361.1| 175|Drosophila melanogaster RH47329p pro... 103 2e-22 AE013599-1521|AAF58491.1| 175|Drosophila melanogaster CG8816-PA... 103 2e-22 AY094800-1|AAM11153.1| 421|Drosophila melanogaster LD24646p pro... 34 0.21 AE014297-764|AAN13388.1| 421|Drosophila melanogaster CG31453-PA... 34 0.21 BT016053-1|AAV36938.1| 253|Drosophila melanogaster LP16969p pro... 31 1.1 BT001841-1|AAN71599.1| 304|Drosophila melanogaster RH52725p pro... 31 1.1 AY296751-1|AAP57411.1| 253|Drosophila melanogaster UMP-CMP kina... 31 1.1 AY119622-1|AAM50276.1| 253|Drosophila melanogaster LD46840p pro... 31 1.1 AE014297-3912|AAF56560.1| 253|Drosophila melanogaster CG6092-PA... 31 1.1 AB025925-1|BAA86921.1| 196|Drosophila melanogaster Dak1L protein. 31 1.1 AB025924-1|BAA86920.1| 196|Drosophila melanogaster Dak1 protein. 31 1.1 U30502-1|AAA75044.1| 752|Drosophila melanogaster Drosophila N-e... 30 2.6 U28836-1|AAC46844.1| 744|Drosophila melanogaster N-ethylmaleimi... 30 2.6 BT023784-1|AAZ41793.1| 752|Drosophila melanogaster LD09622p pro... 30 2.6 AE014297-1767|AAF54995.2| 752|Drosophila melanogaster CG33101-P... 30 2.6 U15967-1|AAB60241.1| 331|Drosophila melanogaster rfc40 protein. 30 3.4 AY094829-1|AAM11182.1| 331|Drosophila melanogaster LD40483p pro... 30 3.4 AY051480-1|AAK92904.1| 736|Drosophila melanogaster GH14313p pro... 30 3.4 AE014296-772|AAF47843.1| 331|Drosophila melanogaster CG14999-PA... 30 3.4 AE013599-3496|AAM71132.2| 736|Drosophila melanogaster CG3499-PB... 30 3.4 AY061115-1|AAL28663.1| 299|Drosophila melanogaster LD09945p pro... 29 6.0 AL009191-3|CAA15685.1| 299|Drosophila melanogaster EG:39E1.2 pr... 29 6.0 AE014298-303|AAF45700.1| 299|Drosophila melanogaster CG3587-PA ... 29 6.0 >AY071739-1|AAL49361.1| 175|Drosophila melanogaster RH47329p protein. Length = 175 Score = 103 bits (248), Expect = 2e-22 Identities = 45/75 (60%), Positives = 51/75 (68%) Frame = +1 Query: 460 PVFE*R*VAGHYGRYDAKGGNIVDYHSCDFFPERWFDGVFVIRCNNTTLYDRLAARGYTG 639 P+ + + H AKGGN+V+YH CDFFPERWF VFV+ C NTTLYDRL R Y Sbjct: 60 PILDEEKLMDHLEPLMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNE 119 Query: 640 KKLEDNIQCEIFATI 684 KKL NIQCEIF TI Sbjct: 120 KKLASNIQCEIFGTI 134 Score = 91.9 bits (218), Expect = 7e-19 Identities = 38/68 (55%), Positives = 49/68 (72%) Frame = +2 Query: 311 PNVLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQEHNCLDEYDPEYQCPFLNEDKLLD 490 PN+L+TGTPG GKS LC +A KF W D S IA+E N ++EYD EY CP L+E+KL+D Sbjct: 10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMD 69 Query: 491 IMEGMMQK 514 +E +M K Sbjct: 70 HLEPLMAK 77 >AE013599-1521|AAF58491.1| 175|Drosophila melanogaster CG8816-PA protein. Length = 175 Score = 103 bits (248), Expect = 2e-22 Identities = 45/75 (60%), Positives = 51/75 (68%) Frame = +1 Query: 460 PVFE*R*VAGHYGRYDAKGGNIVDYHSCDFFPERWFDGVFVIRCNNTTLYDRLAARGYTG 639 P+ + + H AKGGN+V+YH CDFFPERWF VFV+ C NTTLYDRL R Y Sbjct: 60 PILDEEKLMDHLEPLMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNE 119 Query: 640 KKLEDNIQCEIFATI 684 KKL NIQCEIF TI Sbjct: 120 KKLASNIQCEIFGTI 134 Score = 91.9 bits (218), Expect = 7e-19 Identities = 38/68 (55%), Positives = 49/68 (72%) Frame = +2 Query: 311 PNVLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQEHNCLDEYDPEYQCPFLNEDKLLD 490 PN+L+TGTPG GKS LC +A KF W D S IA+E N ++EYD EY CP L+E+KL+D Sbjct: 10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMD 69 Query: 491 IMEGMMQK 514 +E +M K Sbjct: 70 HLEPLMAK 77 >AY094800-1|AAM11153.1| 421|Drosophila melanogaster LD24646p protein. Length = 421 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = +2 Query: 221 LKQKLLEVILWYLSSSFTKYQIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADR 379 LK+KLL+ L L F+++++ N +L+ G PG GK++LC+ LA + Sbjct: 139 LKEKLLKFALSALM--FSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQK 189 >AE014297-764|AAN13388.1| 421|Drosophila melanogaster CG31453-PA protein. Length = 421 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = +2 Query: 221 LKQKLLEVILWYLSSSFTKYQIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADR 379 LK+KLL+ L L F+++++ N +L+ G PG GK++LC+ LA + Sbjct: 139 LKEKLLKFALSALM--FSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQK 189 >BT016053-1|AAV36938.1| 253|Drosophila melanogaster LP16969p protein. Length = 253 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 66 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 100 >BT001841-1|AAN71599.1| 304|Drosophila melanogaster RH52725p protein. Length = 304 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 117 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 151 >AY296751-1|AAP57411.1| 253|Drosophila melanogaster UMP-CMP kinase protein. Length = 253 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 66 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 100 >AY119622-1|AAM50276.1| 253|Drosophila melanogaster LD46840p protein. Length = 253 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 66 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 100 >AE014297-3912|AAF56560.1| 253|Drosophila melanogaster CG6092-PA protein. Length = 253 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 66 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 100 >AB025925-1|BAA86921.1| 196|Drosophila melanogaster Dak1L protein. Length = 196 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 9 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 43 >AB025924-1|BAA86920.1| 196|Drosophila melanogaster Dak1 protein. Length = 196 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 317 VLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQE 421 V V G PG GK T C + DR +F ++ +E Sbjct: 9 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLRE 43 >U30502-1|AAA75044.1| 752|Drosophila melanogaster Drosophila N-ethylmaleimide-sensitivefusion protein 2 protein. Length = 752 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 281 QIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADRTKF 388 Q K L +VL+ G P GKS L NLA + F Sbjct: 532 QAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDF 567 >U28836-1|AAC46844.1| 744|Drosophila melanogaster N-ethylmaleimide sensitive fusionprotein-2 protein. Length = 744 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 281 QIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADRTKF 388 Q K L +VL+ G P GKS L NLA + F Sbjct: 524 QAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDF 559 >BT023784-1|AAZ41793.1| 752|Drosophila melanogaster LD09622p protein. Length = 752 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 281 QIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADRTKF 388 Q K L +VL+ G P GKS L NLA + F Sbjct: 532 QAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDF 567 >AE014297-1767|AAF54995.2| 752|Drosophila melanogaster CG33101-PA protein. Length = 752 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 281 QIKMNSGRTLPNVLVTGTPGVGKSTLCRNLADRTKF 388 Q K L +VL+ G P GKS L NLA + F Sbjct: 532 QAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDF 567 >U15967-1|AAB60241.1| 331|Drosophila melanogaster rfc40 protein. Length = 331 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 311 PNVLVTGTPGVGKSTLCRNLA 373 PN+++ G PGVGK+T + LA Sbjct: 50 PNIIIAGPPGVGKTTTIQCLA 70 >AY094829-1|AAM11182.1| 331|Drosophila melanogaster LD40483p protein. Length = 331 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 311 PNVLVTGTPGVGKSTLCRNLA 373 PN+++ G PGVGK+T + LA Sbjct: 50 PNIIIAGPPGVGKTTTIQCLA 70 >AY051480-1|AAK92904.1| 736|Drosophila melanogaster GH14313p protein. Length = 736 Score = 29.9 bits (64), Expect = 3.4 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 224 KQKLLEVILWYLSSSFTKYQIKMNSGRTLPN-VLVTGTPGVGKSTLCRNLADRTK 385 KQ+L EV+ + S K+ N G LP VL+ G PG GK+ L R +A K Sbjct: 309 KQELKEVVEFLKSPE--KFS---NLGGKLPKGVLLVGPPGTGKTLLARAVAGEAK 358 >AE014296-772|AAF47843.1| 331|Drosophila melanogaster CG14999-PA protein. Length = 331 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 311 PNVLVTGTPGVGKSTLCRNLA 373 PN+++ G PGVGK+T + LA Sbjct: 50 PNIIIAGPPGVGKTTTIQCLA 70 >AE013599-3496|AAM71132.2| 736|Drosophila melanogaster CG3499-PB protein. Length = 736 Score = 29.9 bits (64), Expect = 3.4 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 224 KQKLLEVILWYLSSSFTKYQIKMNSGRTLPN-VLVTGTPGVGKSTLCRNLADRTK 385 KQ+L EV+ + S K+ N G LP VL+ G PG GK+ L R +A K Sbjct: 309 KQELKEVVEFLKSPE--KFS---NLGGKLPKGVLLVGPPGTGKTLLARAVAGEAK 358 >AY061115-1|AAL28663.1| 299|Drosophila melanogaster LD09945p protein. Length = 299 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 308 LPNVLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQ 418 +P V++TG P GKST R L D R V I++ Sbjct: 1 MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISE 37 >AL009191-3|CAA15685.1| 299|Drosophila melanogaster EG:39E1.2 protein. Length = 299 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 308 LPNVLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQ 418 +P V++TG P GKST R L D R V I++ Sbjct: 1 MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISE 37 >AE014298-303|AAF45700.1| 299|Drosophila melanogaster CG3587-PA protein. Length = 299 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 308 LPNVLVTGTPGVGKSTLCRNLADRTKFAWRDVSNIAQ 418 +P V++TG P GKST R L D R V I++ Sbjct: 1 MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISE 37 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,000,670 Number of Sequences: 53049 Number of extensions: 624440 Number of successful extensions: 1595 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1595 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -