BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00333 (815 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0086 - 699617-699766,699851-699908,699998-700068,700210-70... 29 3.3 >03_01_0086 - 699617-699766,699851-699908,699998-700068,700210-700286, 700384-700466,700545-700604,700848-700983,701056-701126, 701248-701339,701454-701551,701891-702043,702146-702311, 702457-702885,703076-703157,703245-703504 Length = 661 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 701 SGIATAV*DFCSDFWCFWY-TIKNYIFQWQLKYFGIFKMRFYDWFLS 564 SG A DFC W W ++ YI QW+ K+ DW S Sbjct: 405 SGFAFDEDDFCRP-WEGWQDNLERYILQWESKHIIAVSTAIQDWLTS 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,959,282 Number of Sequences: 37544 Number of extensions: 355570 Number of successful extensions: 828 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -