BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00333 (815 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33877| Best HMM Match : CDI (HMM E-Value=2.2e-12) 29 3.4 SB_18998| Best HMM Match : Exo_endo_phos (HMM E-Value=1.1e-10) 29 6.0 >SB_33877| Best HMM Match : CDI (HMM E-Value=2.2e-12) Length = 228 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 180 ELHKTSNSSNGTVVEKKPISR 242 ELH T+ S++GTV +KP SR Sbjct: 123 ELHTTTKSTDGTVARRKPKSR 143 >SB_18998| Best HMM Match : Exo_endo_phos (HMM E-Value=1.1e-10) Length = 422 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 540 SLGRIPDTTEKPVIESHFKYAKVFQLPLKNIIFDGVPETPKVGTEISN 683 S+ RIPD+ P++ K+ + P+ NI+ G P + E N Sbjct: 112 SVYRIPDSNVDPLVALDGALCKLVKNPIPNILITGDLNLPSISWEDDN 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,298,388 Number of Sequences: 59808 Number of extensions: 462237 Number of successful extensions: 1035 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -