BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00332 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1359 + 26382605-26382815,26382907-26382998,26383722-263837... 28 5.9 02_05_0061 + 25506648-25509399,25509564-25509901,25510392-255105... 28 5.9 >08_02_1359 + 26382605-26382815,26382907-26382998,26383722-26383791, 26383895-26384013,26384580-26384676,26384781-26384860, 26384986-26385180,26385460-26385520,26386408-26386468, 26386900-26386993,26387085-26387157,26387158-26387270, 26387444-26387587 Length = 469 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 249 TMRIERISSSFRIDYCLLVGLKVSLSSQRIFKNNCAVI 136 T +E I SF D CLLVG++ + + ++ +N + + Sbjct: 384 TGSVEFIQCSFHSDVCLLVGMRTTEVTAKVSYHNYSTV 421 >02_05_0061 + 25506648-25509399,25509564-25509901,25510392-25510593, 25510779-25510854,25512036-25512294 Length = 1208 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 343 D*MKLNIENFFSLTPITIYNMLSVQCFRANLNN 245 D + L NF PIT+ NM+S+ R + NN Sbjct: 474 DSLDLGRNNFSGSIPITVGNMVSLSSLRFSFNN 506 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,454,759 Number of Sequences: 37544 Number of extensions: 182796 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -