BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00328 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.5 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 3.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 3.3 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 493 PSRPNFLKVK*EPQSNRSSLQLGTRGADSAPT 588 PS P EP+S S GT GA +APT Sbjct: 1490 PSVPPATTTDLEPESGVSEAPPGTDGAAAAPT 1521 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 562 FPTVVNFYCFGALI*LLRSWGETGPRQSKASRALTLHCDIVHKRHEALLRI 410 FP +V YC+G++ + T PR ++ R ++ D++ + LR+ Sbjct: 223 FPLIVILYCYGSI--YYEIFSRTNPRNLESFRRSSI--DVLGRAKRKTLRM 269 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 562 FPTVVNFYCFGALI*LLRSWGETGPRQSKASRALTLHCDIVHKRHEALLRI 410 FP +V YC+G++ + T PR ++ R ++ D++ + LR+ Sbjct: 223 FPLIVILYCYGSI--YYEIFSRTNPRNLESFRRSSI--DVLGRAKRKTLRM 269 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 458,647 Number of Sequences: 2352 Number of extensions: 6870 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -