Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00318
         (776 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g27520.1 68414.m03355 glycoside hydrolase family 47 protein S...    29   4.5  

>At1g27520.1 68414.m03355 glycoside hydrolase family 47 protein
           Similar to gb|U04299 mannosyl-oligosaccharide
           alpha-1,2-mannosidase from Mus musculus. ESTs gb|R84145
           and gb|AA394707 come from this gene
          Length = 574

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
 Frame = +3

Query: 426 PICSKCIFLCVL*SITQIV----RTHIHVRTMACIFQVQTNYRHVYSNY 560
           PI  + +FLC+L S+T  V      HI V+      +V+  + H Y NY
Sbjct: 4   PIHPRRLFLCLLISLTFFVVDPSSQHIEVKKKQMREKVREMFYHAYDNY 52


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,312,361
Number of Sequences: 28952
Number of extensions: 326077
Number of successful extensions: 693
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 676
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 693
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1736283200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)