BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00317 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 23 3.6 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 23 3.6 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 23 3.6 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 4.8 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 603 IFSIPLAVLFIKHM*YLRLVFHNSYCKEMKNVALIWSQPFMFVVLNV 743 I + L +L + H + N +CK ++N+ L FVV NV Sbjct: 63 ILDVILLILNV-HTILTTITKRNQWCKLLENLKLDRENNSSFVVANV 108 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 603 IFSIPLAVLFIKHM*YLRLVFHNSYCKEMKNVALIWSQPFMFVVLNV 743 I + L +L + H + N +CK ++N+ L FVV NV Sbjct: 63 ILDVILLILNV-HTILTTITKRNQWCKLLENLKLDRENNSSFVVANV 108 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 603 IFSIPLAVLFIKHM*YLRLVFHNSYCKEMKNVALIWSQPFMFVVLNV 743 I + L +L + H + N +CK ++N+ L FVV NV Sbjct: 383 ILDVILLILNV-HTILTTITKRNQWCKLLENLKLDRENNSSFVVANV 428 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 213 KKVFFLSLTLLDNLIFG 263 KK +FL + L+D LI G Sbjct: 53 KKCYFLRMVLIDLLIVG 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,646 Number of Sequences: 336 Number of extensions: 3792 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -