BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00316 (575 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0070 - 14755864-14756157,14756853-14757011 31 0.87 08_02_1457 + 27260841-27260965,27261126-27261246,27263455-272635... 30 1.1 09_06_0246 + 21837144-21838194,21838692-21840038,21840576-218406... 28 4.6 03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750,395... 28 4.6 10_01_0117 + 1447741-1449123 28 6.1 07_03_0082 - 13222635-13223350,13223368-13223928,13224095-132248... 27 8.1 >02_03_0070 - 14755864-14756157,14756853-14757011 Length = 150 Score = 30.7 bits (66), Expect = 0.87 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +2 Query: 212 PGLQGSSLGKDFSPAIPRPGSVPRT-----TATFNYDSGSQQSGHHHNVACNSTMH 364 PG G+ K +PA +P + P+T T F S SQ S H ++ +S+++ Sbjct: 27 PGKLGAQAKKPMTPAAKKPQATPKTKKRRITRLFKKGSSSQSSCHQDELSTHSSVN 82 >08_02_1457 + 27260841-27260965,27261126-27261246,27263455-27263543, 27263776-27263860,27263970-27264074,27264446-27264527, 27264573-27264686,27265029-27265330,27265519-27266114, 27266216-27266376,27266489-27266592,27266697-27266856, 27266942-27267105,27267213-27267545,27267640-27267930, 27268276-27268359,27268430-27268563,27268665-27268892, 27268993-27269164,27269263-27269517,27269778-27270047 Length = 1324 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 435 QGYCKLYYQCHKLDCTQRLLGSYEC 361 Q Y KLYYQ K++C Q +LG EC Sbjct: 194 QPYNKLYYQAIKIECMQ-ILGLSEC 217 >09_06_0246 + 21837144-21838194,21838692-21840038,21840576-21840656, 21842740-21842924 Length = 887 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 130 LCMSVRNKRQSNDDDDVLDDRYGWELTT 213 LC+ + + S+DDDD DD W+LTT Sbjct: 653 LCLYLDSDDDSDDDDD--DDCCAWDLTT 678 >03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750, 3953942-3954018,3954862-3954958,3955274-3955407, 3955760-3955825,3955954-3956044 Length = 375 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 404 TNWIVLSGYWAATNALLNCRRHCGGAQIV 318 T WI YWA N L NC H G Q V Sbjct: 17 TLWIGDLQYWADENYLYNCFAHTGELQSV 45 >10_01_0117 + 1447741-1449123 Length = 460 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 372 CPVTAEY--NPVCGTDNITYNNPGRLTCAQACGINVSVLRSLPCP 500 CP++ E +PV G ITY+ G A G + S CP Sbjct: 27 CPISLELMRDPVVGPTGITYDRAGIEAWLLAAGAGKTAAASSTCP 71 >07_03_0082 - 13222635-13223350,13223368-13223928,13224095-13224839, 13226548-13226638,13227330-13227342,13227633-13227689, 13229170-13229260,13229444-13229476,13229588-13230085 Length = 934 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 285 VLGTDPGRGIAGEKSLPRELPWRPGGKLP 199 VLG D G GI E + PW G +LP Sbjct: 313 VLGKDQGFGIDVELGFVLQSPWGRGSRLP 341 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,398,467 Number of Sequences: 37544 Number of extensions: 289050 Number of successful extensions: 863 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -