BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00314 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 26 1.1 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 26 1.4 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 26 1.4 DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 25 2.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 3.2 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 4.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 5.6 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 7.4 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 7.4 DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted ... 23 9.8 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 350 GDNADCFVKDHRPICSCRNGYEGDPYRTC 436 GD+ C K C CRNGY D Y C Sbjct: 83 GDHLAC-TKHCVEGCFCRNGYVRDKYDRC 110 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 25.8 bits (54), Expect = 1.4 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +3 Query: 45 ATVLNEPECIMDGDCPSGHACLKDECREACSELKPCKGNSRCSVSDSI 188 AT E C + C + H C E RE + C G C SD + Sbjct: 49 ATFKGERFCTL---CDTRHFCECKETREPLPYMYACPGTEPCQSSDRL 93 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 25.8 bits (54), Expect = 1.4 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -2 Query: 509 DLYNFHLYKLLGCHTLNLYGNPQRDKCGKDLLRIHYGMNK*VYDL*QNNPRYHHS 345 D Y FHL LL L+ P+ KC +DL+ G N+ DL ++HS Sbjct: 127 DAY-FHL--LLLVRLLDKNDLPKATKCSQDLMAKVVGQNRRSLDLIAAKSYFYHS 178 >DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 85 Score = 25.0 bits (52), Expect = 2.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 207 CRCPEGFVPSEDGSCKR 257 C C +GF+ +E+G C R Sbjct: 61 CFCKDGFLRNENGKCVR 77 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 3.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 66 ECIMDGDCPSGHACLKDECR 125 +C GDCP H +D CR Sbjct: 232 QCPAVGDCPDQHIVERDCCR 251 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 307 LVCAVIIRRATKGW*IGRLQLPSSEGTKPSGQRQIRVRNGI 185 +V A ++RR GW G+L++ T P+ Q +++ I Sbjct: 481 IVIARLVRRYEVGWNYGKLKVKMGFVTTPTVPLQFELKDVI 521 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 389 ICSCRNGYEGDPYRTCRV 442 +CSC+ EG R CR+ Sbjct: 464 VCSCKENVEGRHCRECRL 481 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 461 SECDTREACINGNCIN 508 +EC T + +NG CIN Sbjct: 552 AECPTTKHAMNGTCIN 567 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 102 ACLKDECREACSELKPCKGNSR 167 AC K C++A + C G SR Sbjct: 251 ACKKSTCQQAYDTFQNCFGESR 272 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 102 ACLKDECREACSELKPCKGNSR 167 AC K C++A + C G SR Sbjct: 251 ACKKSTCQQAYDTFQNCFGESR 272 >DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted peptide protein. Length = 89 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +1 Query: 517 TNSTCGPNAECFVQKNQPLCRCRVGFEGDAYLG 615 T+ C N + + C CR+G++ D G Sbjct: 36 TDDGCDDNCQGSCIPMKDFCACRIGYKRDLTSG 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 853,890 Number of Sequences: 2352 Number of extensions: 21390 Number of successful extensions: 74 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -