BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00314 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21250.1 68414.m02656 wall-associated kinase 1 (WAK1) identic... 42 3e-04 At1g69730.1 68414.m08024 protein kinase family protein contains ... 38 0.007 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 38 0.007 At1g16110.1 68414.m01931 wall-associated kinase, putative contai... 37 0.016 At1g79680.1 68414.m09293 wall-associated kinase, putative simila... 36 0.028 At1g21270.1 68414.m02658 wall-associated kinase 2 (WAK2) identic... 35 0.065 At1g16260.1 68414.m01947 protein kinase family protein contains ... 35 0.065 At5g66790.1 68418.m08420 protein kinase family protein contains ... 34 0.11 At1g16160.1 68414.m01936 protein kinase family protein contains ... 33 0.15 At1g16140.1 68414.m01934 wall-associated kinase, putative contai... 33 0.20 At5g42090.1 68418.m05124 expressed protein 33 0.26 At1g27080.1 68414.m03301 proton-dependent oligopeptide transport... 32 0.35 At1g21230.1 68414.m02653 wall-associated kinase, putative simila... 32 0.35 At1g19390.1 68414.m02412 wall-associated kinase, putative simila... 32 0.35 At4g31100.1 68417.m04414 wall-associated kinase, putative 32 0.46 At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nea... 32 0.46 At1g21210.1 68414.m02651 wall-associated kinase 4 32 0.46 At4g20110.1 68417.m02943 vacuolar sorting receptor, putative sim... 31 1.1 At3g55270.1 68416.m06138 MAP kinase phosphatase (MKP1) identical... 30 1.8 At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide... 30 1.8 At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide... 30 1.8 At1g61360.1 68414.m06915 S-locus lectin protein kinase family pr... 30 1.8 At2g30290.1 68415.m03687 vacuolar sorting receptor, putative sim... 29 2.4 At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 29 2.4 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 29 2.4 At1g30900.1 68414.m03780 vacuolar sorting receptor, putative sim... 29 2.4 At2g34940.1 68415.m04289 vacuolar sorting receptor, putative sim... 29 4.3 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 28 5.6 At1g18860.1 68414.m02348 WRKY family transcription factor contai... 28 5.6 At1g16120.1 68414.m01932 wall-associated kinase, putative contai... 28 7.4 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 28 7.4 At5g50990.1 68418.m06322 pentatricopeptide (PPR) repeat-containi... 27 9.8 At4g11900.1 68417.m01893 S-locus lectin protein kinase family pr... 27 9.8 At2g19130.1 68415.m02233 S-locus lectin protein kinase family pr... 27 9.8 At1g47320.1 68414.m05239 expressed protein similar to putative n... 27 9.8 >At1g21250.1 68414.m02656 wall-associated kinase 1 (WAK1) identical to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by pathogen infection (PMID:10380805) Length = 735 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 517 TNSTCGPNAECF--VQKNQPLCRCRVGFEGDAYLGCNAIECRSNGDCPRDKQCKAHRCIN 690 + S CG N+ C +N +CRC GF+G+ YL C+ +C H C + Sbjct: 243 STSICGGNSTCLDSTPRNGYICRCNEGFDGNPYLSAG---CQDVNECTTSSTIHRHNCSD 299 Query: 691 P 693 P Sbjct: 300 P 300 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 350 GDNADCFVKDHRP--ICSCRNGYEGDPYRTCRVVGCRTNSECDTREACINGNC 502 G N+ C R IC C G++G+PY + GC+ +EC T NC Sbjct: 248 GGNSTCLDSTPRNGYICRCNEGFDGNPYLS---AGCQDVNECTTSSTIHRHNC 297 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 150 CKGNSRCSVSDSIPFRTLICRCPEGF 227 C GNS C DS P ICRC EGF Sbjct: 247 CGGNSTCL--DSTPRNGYICRCNEGF 270 >At1g69730.1 68414.m08024 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 792 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSECDTREA---CINGNCINL 511 CSC G++G+PY R+ GC+ +EC E C C+NL Sbjct: 320 CSCTRGFQGNPY---RLGGCKDINECKEEEGMTYCGTNKCVNL 359 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +2 Query: 350 GDNADCFVKDHRP--ICSCRNGYEGDPYRTCRVVGCRTNSEC--DTREACINGNCIN 508 G N+ C+ R IC C GY+G+PYR+ GC+ EC DT C N Sbjct: 259 GKNSSCYNSTTRNGYICKCNEGYDGNPYRS---EGCKDIDECISDTHNCSDPKTCRN 312 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 3/77 (3%) Frame = +3 Query: 126 EACSELKPCKGNSR-CSVSDSIPFRT--LICRCPEGFVPSEDGSCKRPIYHPLVALRIMT 296 E C ++ C ++ CS + R C+CP G+ + SC RP Y ++ Sbjct: 289 EGCKDIDECISDTHNCSDPKTCRNRDGGFDCKCPSGYDLNSSMSCTRPEYKRTRIFLVII 348 Query: 297 AQTKSLVLTEIAEIHVT 347 L+L I H T Sbjct: 349 IGVLVLLLAAICIQHAT 365 >At1g16110.1 68414.m01931 wall-associated kinase, putative contains similarity to wall-associated kinase 2 GI:4826399 from [Arabidopsis thaliana] Length = 642 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 389 ICSCRNGYEGDPYRTCRVVGCRTNSECDTREACINGNCINL 511 IC C GY G+PY GC EC+ C G C+N+ Sbjct: 303 ICYCNYGYTGNPYLR---HGCIDIDECEGHHNCGEGTCVNM 340 >At1g79680.1 68414.m09293 wall-associated kinase, putative similar to wall-associated kinase 2 GI:4826399 from [Arabidopsis thaliana] Length = 769 Score = 35.9 bits (79), Expect = 0.028 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVG-CRTNSEC----DTREACINGNCINLV 514 CSC +G+EG+PY + G C+ +EC D C G C+NL+ Sbjct: 305 CSCASGFEGNPY----IPGECKDINECVRGIDGNPVCTAGKCVNLL 346 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +1 Query: 574 CRCRVGFEGDAYLGCNAIECRSNGDCPR----DKQCKAHRCIN 690 C C GFEG+ Y+ EC+ +C R + C A +C+N Sbjct: 305 CSCASGFEGNPYI---PGECKDINECVRGIDGNPVCTAGKCVN 344 >At1g21270.1 68414.m02658 wall-associated kinase 2 (WAK2) identical to wall-associated kinase 2 [Arabidopsis thaliana] GI:4826399; induced by salicylic acid or INA (PMID:10380805) Length = 732 Score = 34.7 bits (76), Expect = 0.065 Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 6/65 (9%) Frame = +1 Query: 496 KLYKSCLTNSTCGPNAECFVQKNQP--LCRCRVGFEGDAYL--GCNAI-EC-RSNGDCPR 657 K K CG N+ CF C+C GFEG+ YL GC I EC S +C Sbjct: 232 KTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSE 291 Query: 658 DKQCK 672 C+ Sbjct: 292 HSTCE 296 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 12/63 (19%) Frame = +2 Query: 350 GDNADCFVKDHRP--ICSCRNGYEGDPY--RTCRVV--------GCRTNSECDTREACIN 493 G N+ CF C C G+EG+PY C+ + C +S C+ + N Sbjct: 244 GGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFN 303 Query: 494 GNC 502 NC Sbjct: 304 CNC 306 >At1g16260.1 68414.m01947 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 34.7 bits (76), Expect = 0.065 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSEC-DTR-EACINGNCINLV 514 CSC NGYEG+PY GC+ EC D C C+N++ Sbjct: 266 CSCHNGYEGNPYIP---GGCQDIDECRDPHLNKCGKRKCVNVL 305 Score = 34.3 bits (75), Expect = 0.086 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +1 Query: 490 KWKLYKSCLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYL--GCNAI-ECRSNGDCPRD 660 +W+L S +T+ F + + C C G+EG+ Y+ GC I ECR P Sbjct: 239 EWRLDLSYMTSKRVLCKGNTFFEDSYQ-CSCHNGYEGNPYIPGGCQDIDECRD----PHL 293 Query: 661 KQCKAHRCIN 690 +C +C+N Sbjct: 294 NKCGKRKCVN 303 >At5g66790.1 68418.m08420 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 622 Score = 33.9 bits (74), Expect = 0.11 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 8/59 (13%) Frame = +1 Query: 493 WKLYKSCLTNSTCGPNAECFVQKNQP-----LCRCRVGFEGDAYL---GCNAIECRSNG 645 W L SC +N+TC NA+C K C CR GF G A+ GC+ + + G Sbjct: 187 WWLKGSC-SNTTCSENADCAKVKLDDGGLGHRCTCREGFSGKAFTVPGGCHRLVYKRKG 244 >At1g16160.1 68414.m01936 protein kinase family protein contains similarity to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana] Length = 711 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSECDTREACINGNCINL 511 C C G+ G+PY GC N +C C G C+N+ Sbjct: 280 CYCSLGFTGNPYLRG---GCIDNDDCKGPNICEEGTCVNV 316 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = +1 Query: 508 SCLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYLGCNAIECRSNGDCPRDKQCKAHRCI 687 S L+ +C F + + C C +GF G+ YL C N DC C+ C+ Sbjct: 258 SYLSGDSCLCEYGYFSEMSYRNCYCSLGFTGNPYLRGG---CIDNDDCKGPNICEEGTCV 314 Query: 688 N 690 N Sbjct: 315 N 315 >At1g16140.1 68414.m01934 wall-associated kinase, putative contains similarity to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana] Length = 690 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSECDTREACINGNCINL 511 C C +GY G+PY GC EC+ C C+N+ Sbjct: 272 CYCGSGYRGNPYIR---GGCIDIDECEVPNKCGEDTCVNM 308 >At5g42090.1 68418.m05124 expressed protein Length = 439 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -1 Query: 327 FLLTQDSWS--VQSLSEEQPRGGKLAACSYHLQKVQSLLGNDKSEFGTVY 184 FL T+D+W +Q L EE+ + H+ +L G DKS F TV+ Sbjct: 75 FLCTRDAWVHVIQQLEEEEITCALQSDLVKHVFTFNNLKGGDKSRFSTVF 124 >At1g27080.1 68414.m03301 proton-dependent oligopeptide transport (POT) family protein similar to nitrate transporter NRT1-5 [Glycine max] GI:11933414; contains Pfam profile PF00854: POT family Length = 525 Score = 32.3 bits (70), Expect = 0.35 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -3 Query: 382 MIFNKTIRV-ITTVTWISAISVNTRLLVCAVII 287 +IF+ T+ V + TV+W+ S+ T L+ CAV++ Sbjct: 137 LIFSHTVVVYLQTVSWVIGFSIPTSLMACAVVL 169 >At1g21230.1 68414.m02653 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 733 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 350 GDNADCF--VKDHRPICSCRNGYEGDPYRTCRVVGCRTNSECDTR 478 G N+ CF + C C G++G+PY + GC+ +EC TR Sbjct: 245 GGNSTCFDSTRGKGYNCKCLQGFDGNPYLS---DGCQDINECTTR 286 Score = 31.5 bits (68), Expect = 0.60 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +1 Query: 529 CGPNAECF--VQKNQPLCRCRVGFEGDAYL--GCNAI-ECRSN-GDCPRDKQCK 672 CG N+ CF + C+C GF+G+ YL GC I EC + +C C+ Sbjct: 244 CGGNSTCFDSTRGKGYNCKCLQGFDGNPYLSDGCQDINECTTRIHNCSDTSTCE 297 >At1g19390.1 68414.m02412 wall-associated kinase, putative similar to GB:CAB42872 from [Arabidopsis thaliana] (Plant Mol. Biol. 39 (6), 1189-1196 (1999)) Length = 788 Score = 32.3 bits (70), Expect = 0.35 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +1 Query: 472 HPRSLYKWKLYKSCLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYL--GCNAI-ECRSN 642 + S Y KL SC+ N+ + C C G+EG+ YL GC I EC N Sbjct: 293 YDNSTYNIKLVTSCICNNVTISGTD------YANCGCSQGYEGNPYLPGGCKDINECLRN 346 Query: 643 GDCPRDKQCKAHRCIN 690 R ++ C+N Sbjct: 347 SYGQRQNCRESDTCVN 362 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 392 CSCRNGYEGDPYRT--CRVVG-CRTNSECDTREACINGNCINL 511 C C GYEG+PY C+ + C NS + + C+NL Sbjct: 321 CGCSQGYEGNPYLPGGCKDINECLRNSYGQRQNCRESDTCVNL 363 >At4g31100.1 68417.m04414 wall-associated kinase, putative Length = 786 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +2 Query: 392 CSCRNGYEGDPYRT--CRVVG-CRTNSE-CDTREACIN 493 C C GY+G+PY + CR + C+ N + C + C+N Sbjct: 318 CECNLGYKGNPYDSDGCRDIDECKENPKYCKETDTCVN 355 >At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog (GP:1737218) [Arabidopsis thaliana] Length = 623 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = +1 Query: 511 CLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCI 687 C S G V + C+C +GF+GD C + EC+ C QC +C Sbjct: 475 CWRESRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVC----QCPECKCK 530 Query: 688 N 690 N Sbjct: 531 N 531 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 371 VKDHRPICSCRNGYEGDPYRTCRVVG-CRTNSECDTREA-CIN 493 V DH C C G++GD + C V C+ + C E C N Sbjct: 489 VDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKN 531 >At1g21210.1 68414.m02651 wall-associated kinase 4 Length = 738 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSECDTREACINGNC 502 C C+ G++G+PY GC+ +EC T NC Sbjct: 261 CKCKGGFQGNPYLQ---NGCQDINECTTANPIHKHNC 294 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/71 (25%), Positives = 26/71 (36%) Frame = +1 Query: 505 KSCLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYLGCNAIECRSNGDCPRDKQCKAHRC 684 K C N C +A C+C+ GF+G+ YL C+ +C H C Sbjct: 242 KKCGVNGICSNSASGIGYT----CKCKGGFQGNPYLQNG---CQDINECTTANPIHKHNC 294 Query: 685 INPCFIDNICG 717 +N G Sbjct: 295 SGDSTCENKLG 305 >At4g20110.1 68417.m02943 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222; identical to vacuolar sorting receptor-like protein (GI:2827665) [Arabidopsis thaliana] Length = 625 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 574 CRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 C+C GF+GD L C I EC+ C QC RC N Sbjct: 499 CKCPEGFQGDG-LTCEDINECKERSVC----QCSGCRCKN 533 >At3g55270.1 68416.m06138 MAP kinase phosphatase (MKP1) identical to MAP kinase phosphatase (MKP1) GI:13540262 from [Arabidopsis thaliana] Length = 534 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +2 Query: 488 INGNCINLV*QTAHVDQMPNASFKRTNRCVVVVLDL-KETPI*VVMR*NVDQTEIVHVIS 664 ++ NC +LV D + N + + ++ +DL K+TPI +V R + DQTE++ ++S Sbjct: 475 LDNNC-SLVDSNKAADTVENVDWVQIGESILCQMDLPKDTPIKIV-RESEDQTELLALLS 532 >At2g14720.2 68415.m01657 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 553 VQKNQPLCRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 V K+ C C GF+GD C I EC+ C QC C N Sbjct: 494 VDKDSVKCECPPGFKGDGVKKCEDINECKEKKAC----QCPECSCKN 536 >At2g14720.1 68415.m01656 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 553 VQKNQPLCRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 V K+ C C GF+GD C I EC+ C QC C N Sbjct: 494 VDKDSVKCECPPGFKGDGVKKCEDINECKEKKAC----QCPECSCKN 536 >At1g61360.1 68414.m06915 S-locus lectin protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 821 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 508 SCLTNSTCGPNAECFVQKNQPLCRCRVGFE 597 SC CGP C V+ P+C+C GFE Sbjct: 279 SCDLYGRCGPFGLC-VRSGTPMCQCLKGFE 307 >At2g30290.1 68415.m03687 vacuolar sorting receptor, putative similar to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737218 Length = 625 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +2 Query: 377 DHRPICSCRNGYEGDPYRTCRVVG-CRTNSECDTREA-CIN 493 DH C C G+ GD + C+ V C + C R+ C N Sbjct: 495 DHSKGCKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCKN 535 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 574 CRCRVGFEGDAYLGCNAI-ECRSNGDCP-RDKQCK 672 C+C GF GD C + EC C RD +CK Sbjct: 500 CKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCK 534 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 553 VQKNQPLCRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 V K+ C C GF+GD C I EC+ C QC C N Sbjct: 494 VDKDSVKCECPPGFKGDGTKKCEDINECKEKKAC----QCPECSCKN 536 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 553 VQKNQPLCRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 V K+ C C GF+GD C I EC+ C QC C N Sbjct: 494 VDKDSVKCECPPGFKGDGTKKCEDINECKEKKAC----QCPECSCKN 536 >At1g30900.1 68414.m03780 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 631 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 574 CRCRVGFEGDAYLGCNAI-ECRSNGDCPRDKQCKAHRCIN 690 CRC GF+GD L C I EC+ C QC C N Sbjct: 498 CRCPPGFKGDG-LKCEDIDECKEQSAC----QCDGCNCKN 532 >At2g34940.1 68415.m04289 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 618 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 574 CRCRVGFEGDAYLGCNAI-ECRSNGDCPRDK-QCK 672 CRC +GF GD L C I EC+ C D +CK Sbjct: 497 CRCPLGFLGDG-LKCEDIDECKEKSACKCDGCKCK 530 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 69 CIMDGDCPSGHACLKDECREAC---SELKPCKGNSRCSVSDSIPFRTLICRCPEGFVPSE 239 C G C H R AC + + C+ C S ++ RT P +P E Sbjct: 741 CNRGGQCTFTHTL--QSTRPACKFFASSQGCRNGESCLFSHAMRRRTTSYLPPPQCLPEE 798 Query: 240 DGSCKRPI 263 DGS P+ Sbjct: 799 DGSSTSPL 806 >At1g18860.1 68414.m02348 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 480 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = +3 Query: 147 PC-KGNSRCSVSDSIPFRTLICRCPEG---FVPSEDGSCKRPIYHPLVALRIMTAQTKSL 314 PC + RC+++ S P R + RC E + + +G+ P+ A+ T+ S+ Sbjct: 208 PCPRAYYRCTIAASCPVRKQVQRCSEDMSILISTYEGTHNHPLPMSATAMASATSAAASM 267 Query: 315 VLT 323 +L+ Sbjct: 268 LLS 270 >At1g16120.1 68414.m01932 wall-associated kinase, putative contains similarity to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana] Length = 730 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 392 CSCRNGYEGDPYRTCRVVGCRTNSECDTREAC-INGNCINL 511 C C GY G+PY GC C+ C + +C+N+ Sbjct: 297 CYCDYGYTGNPYLR---GGCVDTDSCEGNHNCGEDAHCVNM 334 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +1 Query: 478 RSLYKWKLYKSCLTNSTCGPNAECFVQKNQPLCRCRVGFEG-DAYL--GCNAIECRSNGD 648 R L +L+ +C G C VQ NQ CRC + Y+ A + Sbjct: 508 RKLLPCRLH-TCNEMCHAGDCPPCLVQVNQK-CRCGSTSRAVECYITTSSEAEKFVCAKP 565 Query: 649 CPRDKQCKAHRCINPC 696 C R K C HRC C Sbjct: 566 CGRKKNCGRHRCSERC 581 >At5g50990.1 68418.m06322 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 511 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +1 Query: 133 VPNLSRAKEIPVVQFQTVYRSEL*FVVAQKALYLLKMVAASGQFTTPWLLFG**LHR 303 + NLS+AK V +Y S + AQK L+ WL FG +HR Sbjct: 334 IQNLSKAKSGDYVLLSNIYSSTKKWESAQKVRELMSKEGIRKAKGKSWLEFGGMIHR 390 >At4g11900.1 68417.m01893 S-locus lectin protein kinase family protein contains Pfam domains, PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain, and PF01453: Lectin (probable mannose binding) Length = 849 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 511 CLTNSTCGPNAECFVQKNQPLCRCRVGFEGDAYLGCNAIECRSNGDCPRD 660 C ++CG C + P CRC GF+ + G + S G C R+ Sbjct: 315 CDVYNSCGSFGICNENREPPPCRCVPGFKREFSQGSDDSNDYSGG-CKRE 363 >At2g19130.1 68415.m02233 S-locus lectin protein kinase family protein contains Pfam domains PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain and PF01453: Lectin (probable mannose binding) Length = 828 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 123 REACSELKPCKGNSRCSVSDSIPFRTLICRCPEGFVP 233 R+ C + C CS S PF CRCP+GF P Sbjct: 287 RQQCQVYRYCGSFGICS-DKSEPF----CRCPQGFRP 318 >At1g47320.1 68414.m05239 expressed protein similar to putative non-LTR retroelement reverse transcriptase GB:AAD21515 GI:4510429 from [Arabidopsis thaliana]; expression supported by MPSS Length = 259 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +3 Query: 33 HCQKATVLNEP----ECIMDGDCPSGHACLKD 116 HC + V E C D DCP H C KD Sbjct: 56 HCSRQQVETELTKVIRCKTDRDCPDSHQCPKD 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,222,209 Number of Sequences: 28952 Number of extensions: 397261 Number of successful extensions: 1039 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -