BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00313 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.32 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.2 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.0 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 6.8 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 9.0 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 223 FSFSPVIDLVYQPSVDRDLHEVVHTEV 143 FSF LVY+PS R HE+ T+V Sbjct: 507 FSFHQWGILVYEPSACRPRHEIRSTDV 533 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 140 PYFGMYH-LVKIPIDRGLVHQVDYWGEGKVTNLDKI-RGFLGATM*TNSLRSS 292 P + +H L++IP D +++D W + L+KI R L N L S Sbjct: 522 PKYDSHHKLIEIPEDLKYFYEIDNWMLDLNSGLNKITRNSLDCFFTMNDLEPS 574 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 140 PYFGMYH-LVKIPIDRGLVHQVDYWGEGKVTNLDKI-RGFLGATM*TNSLRSS 292 P + +H L++IP D +++D W + L+KI R L N L S Sbjct: 522 PKYDSHHKLIEIPEDLKYFYEIDNWMLDLNSGLNKITRNSLDCFFTMNDLEPS 574 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 184 SVDRDLHEVVHTEVGYWGVRIQQVLICVVVWLRGG 80 S+DR +H G W R V VVWL G Sbjct: 120 SLDRYIHIKDPLRYGRWVTRRIAVAGIAVVWLLAG 154 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 353 TATLPVTSETAASKLLPSARGRSLSVALQTSPGLSTRP 466 T TLP S T PSA + + + G +T P Sbjct: 225 TTTLPAASATGTGPATPSAVVATSNATAAMTTGTTTIP 262 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 234 LTR*EASSELQCERTVCARQ*GPQRGKAN 320 LT E + L E++VC + G + KAN Sbjct: 17 LTIEELKTRLHTEQSVCKTETGIDQQKAN 45 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 265 NVNEQFALVSKGHNEGKQIP 324 N+++ A V + + EGK+IP Sbjct: 241 NISQVIACVGQQNVEGKRIP 260 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,583 Number of Sequences: 438 Number of extensions: 3019 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -