BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00312 (580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 5e-12 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 8e-12 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 58 5e-09 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 55 5e-08 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 55 5e-08 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 54 6e-08 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 54 8e-08 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 54 1e-07 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 53 2e-07 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 51 6e-07 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 51 6e-07 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 49 3e-06 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 49 3e-06 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 47 1e-05 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 45 5e-05 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 0.001 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 37 0.014 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.073 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 34 0.096 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) 29 2.7 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 28 4.8 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 76.6 bits (180), Expect = 1e-14 Identities = 41/63 (65%), Positives = 45/63 (71%) Frame = +1 Query: 331 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIS 510 MPLDVL RTRATL S P P G GN +K RAGD LQL +NEEFLVSASH+LALI+ Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT 60 Query: 511 PCP 519 P Sbjct: 61 SLP 63 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 72.5 bits (170), Expect = 2e-13 Identities = 41/64 (64%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +1 Query: 331 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 507 MPLDVLGRTRATL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 508 SPCP 519 + P Sbjct: 61 TSLP 64 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/63 (60%), Positives = 43/63 (68%) Frame = +1 Query: 331 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIS 510 MPLDVLGRTRATL S + G GN +K RAGD +L NEEFLVSASH+LALI+ Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALIT 60 Query: 511 PCP 519 P Sbjct: 61 SLP 63 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 68.1 bits (159), Expect = 5e-12 Identities = 39/64 (60%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 331 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 507 MPLDVLGR R TL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 508 SPCP 519 + P Sbjct: 61 TSLP 64 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 67.3 bits (157), Expect = 8e-12 Identities = 39/64 (60%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +1 Query: 331 MPLDVLGRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 507 MPLDVLGRTR T + P P G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 508 SPCP 519 + P Sbjct: 61 TSLP 64 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 61.3 bits (142), Expect = 6e-10 Identities = 33/57 (57%), Positives = 37/57 (64%) Frame = +1 Query: 349 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GRTRATL P P G GN +K RAGD +L NEEFLVSASH+LALI+ P Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLP 60 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 58.0 bits (134), Expect = 5e-09 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +1 Query: 331 MPLDVLGR-TRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 507 MPLDVLGR R T + +G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 508 SPCP 519 + P Sbjct: 61 TSLP 64 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 54.8 bits (126), Expect = 5e-08 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 174 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 54.8 bits (126), Expect = 5e-08 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 179 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 54.4 bits (125), Expect = 6e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 218 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 54.4 bits (125), Expect = 6e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 54.0 bits (124), Expect = 8e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R ++++ C+ G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 174 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 53.6 bits (123), Expect = 1e-07 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 53.6 bits (123), Expect = 1e-07 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 100 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 52.8 bits (121), Expect = 2e-07 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 179 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 52.8 bits (121), Expect = 2e-07 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 126 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +1 Query: 394 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 P+G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 143 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 52.8 bits (121), Expect = 2e-07 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 126 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 394 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 P+G GN +K RAGD LQL +NEEFLVSA+H+LALI+ P Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLP 83 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.0 bits (119), Expect = 3e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 397 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 +G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 67 KGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 107 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 51.2 bits (117), Expect = 6e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 397 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 +G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Score = 32.7 bits (71), Expect = 0.22 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = +3 Query: 342 CPGPHARYTEGISMFSLA*R-PGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVD*SL 515 C GPHARYT+G++ L + G + +I ++ + S A + SL Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT-SL 60 Query: 516 PFVHTARR 539 PFVHTARR Sbjct: 61 PFVHTARR 68 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 51.2 bits (117), Expect = 6e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 397 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 +G GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Score = 32.7 bits (71), Expect = 0.22 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = +3 Query: 342 CPGPHARYTEGISMFSLA*R-PGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVD*SL 515 C GPHARYT+G++ L + G + +I ++ + S A + SL Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT-SL 60 Query: 516 PFVHTARR 539 PFVHTARR Sbjct: 61 PFVHTARR 68 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 R +++ C+ G GN +K RA D LQL +NEEFLVSASH+LALI+ P Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 400 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 G GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 61 Score = 32.3 bits (70), Expect = 0.29 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 342 CPGPHARYTEGIS-MFSLA*RPGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVD*SL 515 C GPHARYT+G++ F G + +I ++ + S A + SL Sbjct: 2 CSGPHARYTDGVNESFLSTEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALIT-SL 60 Query: 516 PFVHTARR 539 PFVHTARR Sbjct: 61 PFVHTARR 68 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 406 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 406 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 406 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GN +K RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +1 Query: 406 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 40 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +1 Query: 406 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 GN +K RAGD LQL NEEFLVSASH+LALI+ P Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 40 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +1 Query: 400 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALISPCP 519 G GN +K RA D LQL +NEEFLVSASH+LALI+ P Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLP 177 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 44.8 bits (101), Expect = 5e-05 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +1 Query: 427 RAGDWGLQLSPINEEFLVSASHKLALISPCP 519 RAGD LQL +NEEFLVSASH+LALI+ P Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLP 115 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = -1 Query: 496 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 377 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 37.1 bits (82), Expect = 0.010 Identities = 29/65 (44%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +3 Query: 348 GPHARYTEGISMFSLA*RPGQPAETPSCWGLGFAIIPHKRGIPSKRES-*ARVD*SLPFV 524 GPHARYT+G++ L W + AII +RGIPS S + SLPFV Sbjct: 7 GPHARYTDGVNESFL---------RRKAWII--AIIDLERGIPSVSASHQLALITSLPFV 55 Query: 525 HTARR 539 HTARR Sbjct: 56 HTARR 60 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +1 Query: 445 LQLSPINEEFLVSASHKLALISPCP 519 LQL NEEFLVSASH+LALI+ P Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLP 54 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +1 Query: 445 LQLSPINEEFLVSASHKLALISPCP 519 LQL NEEFLVSASH+LALI+ P Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLP 54 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVRPRTSKGITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 34.3 bits (75), Expect = 0.073 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +1 Query: 460 INEEFLVSASHKLALISPCP 519 +NEEFLVSASH+LALI+ P Sbjct: 7 LNEEFLVSASHQLALITSLP 26 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 33.9 bits (74), Expect = 0.096 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 377 DSFSVARVRPRTSKGITD 324 D+ SVARVR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 331 MPLDVLGRTRATLKES 378 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 331 MPLDVLGRTRATL 369 MPLDVLGRTRATL Sbjct: 1 MPLDVLGRTRATL 13 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 81 AIIDLERGIPSVSASHQLALITSLPFVHTARR 112 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 447 AIIPHKRGIPSKRES*A-RVD*SLPFVHTARR 539 AII +RGIPS S + SLPFVHTARR Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTARR 34 >SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) Length = 1150 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 358 RATLKESACSPWPRGPGNPLKLLRA---GDWGLQLSPINEEF 474 +AT+++ P+P G LK++ W L L PIN EF Sbjct: 325 KATVQKVYLKPYPLADGTSLKVIVTEVISPWELWLQPINTEF 366 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 456 PHKRGIPSKRES*A-RVD*SLPFVHTARR 539 P +RGIPS S + SLPFVHTARR Sbjct: 7 PLERGIPSVSASHQLALITSLPFVHTARR 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,435,721 Number of Sequences: 59808 Number of extensions: 424883 Number of successful extensions: 1234 Number of sequences better than 10.0: 83 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -