BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00312 (580 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23517-11|AAY44017.1| 288|Caenorhabditis elegans Hypothetical p... 29 3.2 Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 5.5 U23515-13|AAK21453.1| 823|Caenorhabditis elegans Hypothetical p... 27 7.3 AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical ... 27 7.3 AC024791-31|AAF60655.1| 181|Caenorhabditis elegans Hypothetical... 27 7.3 >U23517-11|AAY44017.1| 288|Caenorhabditis elegans Hypothetical protein D1022.9 protein. Length = 288 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 24 QEWSLRLNLTQHGKSHQARTPEGLTD*QLFLD 119 Q W L L H K + ARTP + D ++F++ Sbjct: 59 QYWPLMLARFSHEKPYVARTPAAIADAEMFIN 90 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -3 Query: 455 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 360 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 >U23515-13|AAK21453.1| 823|Caenorhabditis elegans Hypothetical protein R144.2a protein. Length = 823 Score = 27.5 bits (58), Expect = 7.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 21 HQEWSLRLNLTQHGKSHQARTP 86 H +W ++ NL +HG ++ A P Sbjct: 696 HMDWHVKQNLARHGSNNSAAVP 717 >AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical protein Y39E4B.1 protein. Length = 610 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 481 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 380 L G+P ++G++ P+ EG++ G ENM Sbjct: 300 LYGVPGVYGVVTLPSGVREGINMFLEGFIRTENM 333 >AC024791-31|AAF60655.1| 181|Caenorhabditis elegans Hypothetical protein Y47G6A.3 protein. Length = 181 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 32 EPAA*FDSTREISPGPDTGRIDRL 103 EP+A FD+ ++ PG RIDR+ Sbjct: 100 EPSALFDNANDLLPGQKEERIDRM 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,794,586 Number of Sequences: 27780 Number of extensions: 295399 Number of successful extensions: 765 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1205362812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -