BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00311 (741 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132948-45|CAD31822.2| 542|Caenorhabditis elegans Hypothetical... 32 0.49 Z78417-5|CAB01686.1| 1224|Caenorhabditis elegans Hypothetical pr... 31 0.86 Z83218-7|CAB05685.2| 283|Caenorhabditis elegans Hypothetical pr... 28 8.0 >AL132948-45|CAD31822.2| 542|Caenorhabditis elegans Hypothetical protein Y39B6A.25 protein. Length = 542 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 674 KSLNYYKFNVASLLYRSMHVSRTKCHCHFSSAVKRKLY 561 + L+ Y+ V L R HV R+ CH H+S +K L+ Sbjct: 504 RQLDIYRPRVNHKLPRDNHVYRSMCHPHYSKGIKEFLW 541 >Z78417-5|CAB01686.1| 1224|Caenorhabditis elegans Hypothetical protein C35C5.6 protein. Length = 1224 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 297 TTSQWHALPVDASFHRFPTSVTWKATRYNLNVLSTNKHNDYV 172 T S WH LP D+ F R+ +T ++ ++ +N YV Sbjct: 965 TVSAWHVLPGDSPFSRYIVVDVTNSTEHDAELVYSNSRRMYV 1006 >Z83218-7|CAB05685.2| 283|Caenorhabditis elegans Hypothetical protein C31A11.3 protein. Length = 283 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 710 LFTNVIPVTSSLKSLNYYKFNVASLLYRSMHVSR 609 L+ +IP+ SS+ SL YYKF + + S+ +SR Sbjct: 31 LYLKLIPIKSSM-SLIYYKFGIDAFYTFSICISR 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,255,352 Number of Sequences: 27780 Number of extensions: 330037 Number of successful extensions: 772 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -