BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00311 (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.0 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 9.2 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = -2 Query: 710 LFTNVIPVTSSLKSLNYYKFNVASLLYRSMHVSRTKCHCH 591 L+T +T K+ N YK Y ++ C CH Sbjct: 443 LYTAFDVLTDPKKNPNVYKVETVGDKYMAVSGLPEPCRCH 482 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = -2 Query: 710 LFTNVIPVTSSLKSLNYYKFNVASLLYRSMHVSRTKCHCH 591 L+T +T K+ N YK Y ++ C CH Sbjct: 443 LYTAFDVLTDPKKNPNVYKVETVGDKYMAVSGLPEPCRCH 482 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 608 TKCHCHFSSAVKRKLYKISVATFKN 534 T C +FS+ + LY + A ++N Sbjct: 301 TGCLYYFSTTINPILYNVMSAKYRN 325 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,546 Number of Sequences: 438 Number of extensions: 4117 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -