BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00310 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 3.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 3.0 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 312 IFYRNRTKIDRLEGGNTTVLENKVRQY-YGS 401 + + N K+D N VL NK+ Y YGS Sbjct: 481 LVFPNDIKVDHEYDQNVWVLSNKLAMYLYGS 511 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 199 PFFEQLPAKFPRAVFLKVE*TDAP--IQRVLR 288 PF E+L FPR L T P +Q++LR Sbjct: 141 PFHEKLVESFPRGGSLPTPVTPTPTTVQQLLR 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,572 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -