BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00310 (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 62 4e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 9e-10 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 59 3e-09 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 5e-09 At3g04780.1 68416.m00515 expressed protein 57 1e-08 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 51 9e-07 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 50 1e-06 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 49 3e-06 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 48 9e-06 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 47 1e-05 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 47 2e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 44 8e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 44 8e-05 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 44 1e-04 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 43 2e-04 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 42 4e-04 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 42 4e-04 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 41 0.001 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 40 0.002 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 40 0.002 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 40 0.002 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 39 0.004 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 38 0.005 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 38 0.007 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 38 0.009 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 37 0.012 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 37 0.016 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 36 0.028 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 36 0.028 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.037 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 36 0.037 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 36 0.037 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 36 0.037 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 35 0.049 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 35 0.049 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 35 0.065 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.065 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 35 0.065 At5g40370.1 68418.m04897 glutaredoxin, putative similar to gluta... 34 0.086 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 34 0.086 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 34 0.086 At3g03860.1 68416.m00398 expressed protein 34 0.11 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 34 0.11 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 33 0.26 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 33 0.26 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 33 0.26 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 31 0.61 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 30 1.4 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 30 1.9 At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, ... 29 2.4 At5g18120.1 68418.m02127 expressed protein 29 3.2 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 29 3.2 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 29 4.3 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 29 4.3 At4g16970.1 68417.m02559 protein kinase family protein contains ... 29 4.3 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 28 5.7 At5g03140.1 68418.m00262 lectin protein kinase family protein co... 27 9.9 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 27 9.9 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 62.1 bits (144), Expect = 4e-10 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +1 Query: 115 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 Q + AN LVVVDFTA+WC PC+ IAPFF L K P +FLKV+ Sbjct: 20 QLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVD 66 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 PFF K+ + D AS + AMPTF+F + +D++ G L++ Sbjct: 48 PFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQS 107 Query: 378 KVRQY 392 + ++ Sbjct: 108 TIAKH 112 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 60.9 bits (141), Expect = 9e-10 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 AN KL+V+DFTA+WCPPC+ IAP F ++ KF VF K++ Sbjct: 23 ANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKID 65 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/67 (28%), Positives = 28/67 (41%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 P F K + + VD A V AMPTF+F + IDR+ G + Sbjct: 47 PVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINE 106 Query: 378 KVRQYYG 398 K+ ++ G Sbjct: 107 KLMKHGG 113 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +1 Query: 115 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVE 255 Q + A KL+V+DFTA+WCPPC+ IAP F L KF A+F KV+ Sbjct: 20 QLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVD 67 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 198 PFFRAATSKVSESSIS-QSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLE 374 P F K S+I + VD A GV AMPTF+F + +D+L G N L+ Sbjct: 48 PIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQ 107 Query: 375 NKVRQYYGSDVA 410 K+ ++ G A Sbjct: 108 AKIVKHTGVTTA 119 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 AN KL+V+DFTATWCPPC+ IAP F L K VF KV+ Sbjct: 23 ANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVD 65 >At3g04780.1 68416.m00515 expressed protein Length = 176 Score = 56.8 bits (131), Expect = 1e-08 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%) Frame = +3 Query: 405 VAEEDEDNTVAGHMDLITFITKSECECLNEADDHPLPK-----H*QMTGDTLASYCDEQL 569 ++ E G +DL+ FI S ECLN++ H LP + + G L S DEQL Sbjct: 1 MSAESASQIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALKQGYREDEGLNLESDADEQL 60 Query: 570 IINISFNQLVKLHSIKIK 623 +I I FNQ++KLHS IK Sbjct: 61 LIYIPFNQVIKLHSFAIK 78 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 73 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 T+G T + D + A AG K+VV+D WC PC+ IAP +++L K+ VFLK+ Sbjct: 76 TVGQVTEVDKDTFWPIVKA-AGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKL 134 Query: 253 E 255 + Sbjct: 135 D 135 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/47 (40%), Positives = 32/47 (68%) Frame = +1 Query: 115 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 +T+ A ++L+++ FTATWC PC+ ++P + L + R VFLKV+ Sbjct: 284 KTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVD 330 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/61 (39%), Positives = 35/61 (57%) Frame = +1 Query: 73 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 ++G T + D + A AG KLVV+D WC PC+ IAP ++ L K+ VFLK+ Sbjct: 66 SVGQVTEVDKDTFWPIVKA-AGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKL 124 Query: 253 E 255 + Sbjct: 125 D 125 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 A+ K+VV +F+ATWC PC+ +APFF +L K +FL V+ Sbjct: 41 ADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVD 83 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/62 (35%), Positives = 31/62 (50%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 PFF + K S VD +D +S+ + A PTF F +N +I +L G N L+ Sbjct: 65 PFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQK 124 Query: 378 KV 383 KV Sbjct: 125 KV 126 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 47.2 bits (107), Expect = 1e-05 Identities = 17/38 (44%), Positives = 27/38 (71%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 KL+V+DFTA WC PC+ + P ++ +K+ AVF +V+ Sbjct: 44 KLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVFARVD 81 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 P R SK SE+ ++ VDR D A +P F+F + +IDR+ G L Sbjct: 63 PRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVGAKPDELVK 122 Query: 378 KVRQY 392 K+ Q+ Sbjct: 123 KIEQH 127 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/38 (44%), Positives = 27/38 (71%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 KL+V++FTA WC PC+ + P E+L AK+ F+K++ Sbjct: 60 KLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKID 97 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKV 160 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKV 160 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 KL+VVDF+A+WC PC+ I P + KF F+K++ + P Sbjct: 48 KLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELP 90 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 P A K ++ + VD D A V+AMPTF+ + +I+R+ G LE Sbjct: 67 PAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEK 126 Query: 378 KV 383 KV Sbjct: 127 KV 128 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 I + F + +AG +LV+VDF TWC C+ + P + + P +FLKV Sbjct: 98 ITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKV 150 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/53 (39%), Positives = 29/53 (54%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 IQ+ H + NAG +LVV+DF + C C+ + P QL P +FLKV Sbjct: 90 IQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAETNPNVMFLKV 142 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 91 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 V++++A F + ++ A G+ V FTA WC PC+ I+P +L K+P KV+ Sbjct: 53 VLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVD 109 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/43 (32%), Positives = 29/43 (67%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 AN+ K++VV+F A+WC P + I P +++L + + +F+ ++ Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMIFVTID 100 Score = 31.5 bits (68), Expect = 0.61 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 P ++ S + V+ A+ + V A PT +F ++ ++D+L GG+ L+ Sbjct: 82 PIYQELASTYTSMIFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGDAAELQK 141 Query: 378 K 380 K Sbjct: 142 K 142 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/49 (34%), Positives = 30/49 (61%) Frame = +3 Query: 270 DTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEE 416 + + A V+A+P F+F+++ +D LEG + + L NKV + GS + E Sbjct: 65 EISEAYSVAAVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSSTSAE 113 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 VV+ F A+WC +++ F L FPRA F +VE + P Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHP 64 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/63 (31%), Positives = 34/63 (53%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + + D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 271 IQR 279 Q+ Sbjct: 84 EQK 86 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAPIQRVL 285 K V+V+F A WC C+ +AP +E++ F + + + DA + L Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKAL 207 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/63 (31%), Positives = 34/63 (53%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + + D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 271 IQR 279 Q+ Sbjct: 84 EQK 86 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAPIQRVL 285 K V+V+F A WC C+ +AP +E++ F + + + DA + L Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKAL 207 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 100 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVE*TDAP 270 +D+ +QT++ + V+V+F A WC PC+ I P +QL F + F K+ ++P Sbjct: 92 SDSEWQTKVLESDVP-VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESP 148 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 AN G K + A WC PC++I P F L +++P +F+ V+ Sbjct: 6 ANTGPKERSI--RAPWCVPCKKIEPVFRDLASRYPSMIFVTVD 46 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 91 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TD 264 +++++ F M+ A G+ V FTA WC PC+ I+P +L ++P KV+ + Sbjct: 88 LVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDE 147 Query: 265 APIQRVL 285 I + Sbjct: 148 GGISNTI 154 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 100 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 N +F + + + K VV+F A WCP C+ P +E++ F Sbjct: 41 NTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLF 83 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/67 (25%), Positives = 32/67 (47%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 PF + ++ + +D+C +A+ V +PT Y+N +++ + + VLE Sbjct: 633 PFVDSLCTRYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRVKEIVCPSKEVLEY 692 Query: 378 KVRQYYG 398 VR Y G Sbjct: 693 SVRHYSG 699 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 151 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 V+ F+ C++I+PF + L ++P FLKV+ P Sbjct: 617 VIHFSTASDHQCKQISPFVDSLCTRYPSIHFLKVDIDKCP 656 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 36.7 bits (81), Expect = 0.016 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +1 Query: 124 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 + NAG KLVVVDF + C C+ + P ++ K P FL+V Sbjct: 108 LRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPEVEFLQV 150 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 35.9 bits (79), Expect = 0.028 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVE*TDAP 270 + ND+ + + + A T VVVDF A WC PC+ I P L + + F K+ ++P Sbjct: 84 VVNDSTWDSLVLKA-TGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESP 142 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 255 VDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKV 383 VD + AS V AMPTF+F ++ +D+L G N ++ +V Sbjct: 63 VDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRV 105 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE 255 +V FTA WC P + FFE+L + A+FL V+ Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVD 62 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.5 bits (78), Expect = 0.037 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 270 DTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGS 401 + + A V+ +P F+F+++ +D LEG + + L NKV + GS Sbjct: 65 EISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGS 108 Score = 34.7 bits (76), Expect = 0.065 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 +V+ F A+WC +++ F L FPRA F +VE + P Sbjct: 24 LVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHP 64 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 35.5 bits (78), Expect = 0.037 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQL 216 K V+VDF ATWC PCQ + P ++ Sbjct: 77 KPVLVDFYATWCGPCQLMVPILNEV 101 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 35.5 bits (78), Expect = 0.037 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 100 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 35.5 bits (78), Expect = 0.037 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 100 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 35.1 bits (77), Expect = 0.049 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVE*TD 264 ++VDF ATWC PC +A E L ++ A+ +KV+ D Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDD 136 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 35.1 bits (77), Expect = 0.049 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 124 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 + NAG KLVVVDF + C C+ + P Q P FL+V Sbjct: 112 LTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQV 154 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 34.7 bits (76), Expect = 0.065 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +3 Query: 198 PFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 377 P FR ++ S+ + +D C +T + + PTF FYR+ K+D + G L + Sbjct: 63 PAFRKLSNSFSKLKFVYADIDECPETT--RHIRYTPTFQFYRDGEKVDEMFGAGEQRLHD 120 Query: 378 KV 383 ++ Sbjct: 121 RL 122 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 34.7 bits (76), Expect = 0.065 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQLPAKF 228 V+V+F ATWC PC+ I P E L ++ Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEY 116 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 34.7 bits (76), Expect = 0.065 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVE*TDAP 270 + ND+ + + + A V VDF A WC PC+ I P +L K+ + F K+ ++P Sbjct: 78 VVNDSTWDSLVLKADEP-VFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESP 136 >At5g40370.1 68418.m04897 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] SWISS-PROT:P55143 Length = 111 Score = 34.3 bits (75), Expect = 0.086 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 151 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDAPIQ 276 VV F+ T+CP C R+ +QL AKF +AV L E + IQ Sbjct: 15 VVVFSKTYCPYCVRVKELLQQLGAKF-KAVELDTESDGSQIQ 55 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 34.3 bits (75), Expect = 0.086 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVE*T 261 K V+++F A WC CQ++AP +++ F P + K++ T Sbjct: 391 KNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDAT 433 Score = 32.7 bits (71), Expect = 0.26 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQ 213 +VV+F A WC CQ++AP +E+ Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEK 70 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 34.3 bits (75), Expect = 0.086 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 112 FQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 216 F+ + N+ K V+VD+ ATWC PCQ + P ++ Sbjct: 73 FEDLLVNSD-KPVLVDYYATWCGPCQFMVPILNEV 106 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +3 Query: 195 CPFFRAATSKVSES---SISQSRVD--RCADTASAQGVSAMPTFIFYRNRTKIDRLEGGN 359 C F ++VSE+ I ++D + A+ + A+PTFI +++ DR EG Sbjct: 96 CQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGAL 155 Query: 360 T 362 T Sbjct: 156 T 156 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 136 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDA 267 G + V F A+WCP + + P F+ L + FP+ L VE + A Sbjct: 73 GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQA 116 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 118 TEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 TE+ N+ T V+V FTA WC PC+ + P ++ +++ Sbjct: 221 TEL-NSQTPHVMVMFTARWCGPCRDMIPILNKMDSEY 256 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 130 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 N+G K V+++F A WC CQ++AP +++ + Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSY 421 Score = 32.3 bits (70), Expect = 0.35 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVE 255 +VV+F A WC C+++AP +E+ L + P V K++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKID 89 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 130 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 228 N+G K V+++F A WC CQ++AP +++ + Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSY 421 Score = 32.3 bits (70), Expect = 0.35 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 148 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVE 255 +VV+F A WC C+++AP +E+ L + P V K++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKID 89 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 85 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 A+V N ++F E+ +L +V+F A WC C+++AP Sbjct: 164 ASVELNSSNFD-ELVTESKELWIVEFFAPWCGHCKKLAP 201 Score = 31.5 bits (68), Expect = 0.61 Identities = 12/37 (32%), Positives = 26/37 (70%) Frame = +1 Query: 106 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 216 ++F++++ N+ +V+V+F A WC CQ + P +E++ Sbjct: 36 SNFKSKVLNSNG-VVLVEFFAPWCGHCQSLTPTWEKV 71 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 +++ND Q ++ + K + + F+A WC PCQR P Sbjct: 28 LVRNDGE-QVKVDSLLGKKIGLYFSAAWCGPCQRFTP 63 Score = 30.3 bits (65), Expect = 1.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 142 KLVVVDFTATWCPPCQRIAP 201 K +++ F+A WCPPC+ P Sbjct: 364 KTILMYFSAHWCPPCRAFTP 383 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 94 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 252 I + F + NA +KLVV +F + +I PF +L VFL V Sbjct: 78 IHSGEEFDVALKNAKSKLVVAEFATSKSDQSNKIYPFMVELSRTCNDVVFLLV 130 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/37 (29%), Positives = 26/37 (70%) Frame = +1 Query: 106 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 216 ++F++++ N+ +V+V+F A WC C+ + P +E++ Sbjct: 38 SNFKSKVLNSNG-VVLVEFFAPWCGHCKALTPTWEKV 73 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 85 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 A+V N ++F ++ +L +V+F A WC C+++AP Sbjct: 163 ASVELNASNFD-DLVIESNELWIVEFFAPWCGHCKKLAP 200 >At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, Xenopus laevis, EMBL:XLA249840 Length = 628 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 252 YFEKYCSRKLCW*LLEKRGNPLARWTPSCCKVH 154 Y+E Y R CW LLE + N +A W +VH Sbjct: 156 YYEVYMDR--CWDLLEVKDNEIAVWDDKDGQVH 186 >At5g18120.1 68418.m02127 expressed protein Length = 289 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 127 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVE*TDA 267 AN G + + F + CP + + P F+ L + FP L VE + A Sbjct: 66 ANHGNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQSQA 112 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 121 EMANAGTKLVVVDFTATWCPPCQRIAP 201 E A + K VV+F A WC C+ +AP Sbjct: 132 EEALSNGKPTVVEFYADWCEVCRELAP 158 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 V+ + +F + N + V+V+F A WC CQ +AP Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAP 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 139 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV 240 +K V+++ A WC CQ + P + +L AK R++ Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSI 491 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 V+ + +F + N + V+V+F A WC CQ +AP Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAP 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 139 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV 240 +K V+++ A WC CQ + P + +L AK R++ Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSI 491 >At4g16970.1 68417.m02559 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 868 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 2/86 (2%) Frame = +3 Query: 168 NLVSTVPKDCPFFRAATSKVSESSISQSRVDRCADTASAQGVSAMPTFIFYRNRTKI--D 341 ++VST ++ P +AT + S+ Q +D+C +++ S P I + ++K+ Sbjct: 315 DIVSTPDRELPLKPSATEANQDKSLVQKTLDQCKLPGNSKTYSCSPE-IKHTRKSKVIQK 373 Query: 342 RLEGGNTTVLENKVRQYYGSDVAEED 419 R + NT L+++ Q + + + D Sbjct: 374 RKQNFNTVRLKDQKDQAKHNTIPDFD 399 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 178 PPCQRIAPFFEQLPAKFPRAVFLKVE*TDAP 270 P C+ I+ F + L ++P FLKVE P Sbjct: 648 PQCKEISTFVDALCVRYPSLHFLKVEIVKCP 678 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 261 RCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 392 +C + +A+ V +PTF Y+ ++ + + LE VR Y Sbjct: 676 KCPEVGNAERVRVVPTFKIYKLGIRMKEIVCPSKEALEKTVRHY 719 >At5g03140.1 68418.m00262 lectin protein kinase family protein contains Pfam domains, PF00138: Legume lectins alpha domain, PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 711 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -3 Query: 338 DFGPVSVENECGHCTDALSTRCIGASVYSTLRNTALGNFAGSCSKKGAIL 189 D G + C H + + S+ TLR+ L G C +KG IL Sbjct: 395 DSGEIIAIKRCSHISQGNTEFLSELSLIGTLRHRNLLRLQGYCREKGEIL 444 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 88 TVIQ-NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 201 TV++ D++F + ++ + VDF A WC C+R+ P Sbjct: 33 TVLELTDSNFDSAISTFDC--IFVDFYAPWCGHCKRLNP 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,618,695 Number of Sequences: 28952 Number of extensions: 283653 Number of successful extensions: 830 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -