Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00307
         (746 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    23   2.6  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   7.9  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    21   7.9  

>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 9/35 (25%), Positives = 17/35 (48%)
 Frame = +3

Query: 546 IAHGTNTLLLCNEHSIYVTRISPEGYTVSDI*GDI 650
           +  G N  ++C E  I+   ++P+   V  +  DI
Sbjct: 318 LQEGANKFVICGESDIFNGHLNPDNDEVLQVLEDI 352


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +1

Query: 340 TVCMVVTSIYTW 375
           T C+ +TS+Y W
Sbjct: 41  TTCIYLTSLYIW 52


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +1

Query: 340 TVCMVVTSIYTW 375
           T C+ +TS+Y W
Sbjct: 41  TTCIYLTSLYIW 52


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,317
Number of Sequences: 336
Number of extensions: 4502
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19923648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)