BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00307 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Sch... 27 2.8 SPCC736.04c |gma12||alpha-1,2-galactosyltransferase Gma12 |Schiz... 25 8.7 >SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 495 TVPSIYIQECCLFVKKHPQLYKSCGEYCQFNTRYPTK 385 T P Y + KHP LY++ +FN RY TK Sbjct: 173 TEPIGYSNDWFAATPKHPFLYQAIHNLSKFNHRYFTK 209 >SPCC736.04c |gma12||alpha-1,2-galactosyltransferase Gma12 |Schizosaccharomyces pombe|chr 3|||Manual Length = 375 Score = 25.4 bits (53), Expect = 8.7 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 524 KQFFQNIIF*LYHPYIYKNV-VCLLKSTHNY 435 +Q F +++F YHP +YK+V V LK+ + Y Sbjct: 284 QQAFSHMVF--YHPQVYKHVGVVPLKAINAY 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,133,517 Number of Sequences: 5004 Number of extensions: 68145 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -