BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00307 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.0 AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. 22 7.0 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 746 DITCSKINRFSYALWRLTKICNLKTALQAYHGYVASN 636 D+ K N AL L + N+K L +Y+G + N Sbjct: 378 DLDTKKWNNKISALRALNDLYNVKNTLDSYNGSMEIN 414 >AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. Length = 80 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -1 Query: 485 PYIYKNVVCLLKSTHNYINRV 423 PY YKN++ L + T ++ + V Sbjct: 26 PYGYKNIMTLSQDTSHFASLV 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,610 Number of Sequences: 438 Number of extensions: 4879 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -