BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00306 (549 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X90568-1|CAA62188.1|26926|Homo sapiens titin protein. 41 0.003 AJ277892-3|CAD12457.1| 5604|Homo sapiens Novex-3 Titin Isoform p... 41 0.003 AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. 41 0.003 AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. 41 0.003 AC023270-1|AAX88844.1| 5604|Homo sapiens unknown protein. 41 0.003 X90870-1|CAA62378.1| 458|Homo sapiens myosin-light-chain kinase... 35 0.16 X85337-1|CAA59685.1| 991|Homo sapiens myosin light chain kinase... 35 0.16 U48959-1|AAC18423.2| 1914|Homo sapiens myosin light chain kinase... 35 0.16 DQ533874-1|ABF83431.1| 1378|Homo sapiens ROBO2 isoform b protein. 35 0.16 DQ533873-1|ABF83430.1| 1394|Homo sapiens ROBO2 isoform a protein. 35 0.16 BC146772-1|AAI46773.1| 1378|Homo sapiens roundabout, axon guidan... 35 0.16 BC113458-1|AAI13459.1| 166|Homo sapiens MYLK protein protein. 35 0.16 BC113456-1|AAI13457.1| 167|Homo sapiens MYLK protein protein. 35 0.16 BC107783-1|AAI07784.1| 227|Homo sapiens MYLK protein protein. 35 0.16 BC100763-1|AAI00764.2| 153|Homo sapiens myosin, light chain kin... 35 0.16 BC100762-1|AAI00763.2| 154|Homo sapiens myosin, light chain kin... 35 0.16 BC100761-1|AAI00762.2| 154|Homo sapiens myosin, light chain kin... 35 0.16 BC064420-1|AAH64420.2| 153|Homo sapiens myosin, light chain kin... 35 0.16 BC017811-1|AAH17811.1| 236|Homo sapiens MYLK protein protein. 35 0.16 AY424270-1|AAR29062.1| 1914|Homo sapiens myosin lignt chain poly... 35 0.16 AY424269-1|AAR29061.1| 1845|Homo sapiens myosin light chain poly... 35 0.16 AY339601-1|AAQ02673.1| 1914|Homo sapiens long myosin light chain... 35 0.16 AF096775-1|AAD54019.1| 154|Homo sapiens kinase-related protein ... 35 0.16 AF096774-1|AAD54018.1| 153|Homo sapiens kinase-related protein ... 35 0.16 AF096773-1|AAD54017.1| 154|Homo sapiens kinase-related protein ... 35 0.16 AF096771-2|AAD51381.1| 153|Homo sapiens kinase related protein ... 35 0.16 AF096771-1|AAD51380.1| 300|Homo sapiens smooth muscle/nonmuscle... 35 0.16 AF069604-1|AAD15924.1| 560|Homo sapiens myosin light chain kina... 35 0.16 AF069603-1|AAD15923.1| 1793|Homo sapiens myosin light chain kina... 35 0.16 AF069602-1|AAD15922.1| 1862|Homo sapiens myosin light chain kina... 35 0.16 AF069601-1|AAD15921.2| 1845|Homo sapiens myosin light chain kina... 35 0.16 AB046788-1|BAB13394.1| 1380|Homo sapiens KIAA1568 protein protein. 35 0.16 AB037663-1|BAB21504.1| 992|Homo sapiens myosin light chain kina... 35 0.16 X90569-1|CAA62189.1| 7962|Homo sapiens elastic titin protein. 34 0.29 BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 BC115397-1|AAI15398.1| 867|Homo sapiens IGSF22 protein protein. 34 0.29 BC115022-1|AAI15023.1| 1551|Homo sapiens ROBO1 protein protein. 34 0.29 BC115020-1|AAI15021.1| 1606|Homo sapiens ROBO1 protein protein. 34 0.29 BC112336-1|AAI12337.1| 1607|Homo sapiens ROBO1 protein protein. 34 0.29 AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA seq... 34 0.29 AK095113-1|BAC04488.1| 903|Homo sapiens protein ( Homo sapiens ... 34 0.29 AF040990-1|AAC39575.1| 1651|Homo sapiens roundabout 1 protein. 34 0.29 AK096821-1|BAC04869.1| 405|Homo sapiens protein ( Homo sapiens ... 34 0.38 AC023270-2|AAX88845.1| 405|Homo sapiens unknown protein. 34 0.38 BC070170-1|AAH70170.1| 637|Homo sapiens TTN protein protein. 33 0.50 BC058824-1|AAH58824.1| 558|Homo sapiens TTN protein protein. 33 0.50 BC013396-1|AAH13396.1| 305|Homo sapiens TTN protein protein. 33 0.50 BC117370-1|AAI17371.1| 1065|Homo sapiens leucine-rich repeats an... 33 0.66 BC117368-1|AAI17369.1| 1065|Homo sapiens leucine-rich repeats an... 33 0.66 AL357055-1|CAH73254.1| 1065|Homo sapiens leucine-rich repeats an... 33 0.66 AB018349-1|BAA34526.2| 1073|Homo sapiens KIAA0806 protein protein. 33 0.66 X76132-1|CAA53735.1| 1447|Homo sapiens tumour suppressor protein. 33 0.87 X64698-1|CAA45939.1| 1100|Homo sapiens titin protein. 33 0.87 M32292-1|AAA35751.1| 750|Homo sapiens protein ( Human colorecta... 33 0.87 BC036524-1|AAH36524.1| 772|Homo sapiens DCC protein protein. 33 0.87 AL834247-1|CAD38923.2| 1391|Homo sapiens hypothetical protein pr... 33 0.87 AL832379-1|CAD91155.1| 1045|Homo sapiens hypothetical protein pr... 33 0.87 AL832002-1|CAD89906.1| 1320|Homo sapiens hypothetical protein pr... 33 0.87 AL512429-2|CAH73748.1| 1320|Homo sapiens sarcomeric protein myop... 33 0.87 AL512429-1|CAH73747.1| 1045|Homo sapiens sarcomeric protein myop... 33 0.87 AF328296-1|AAK50625.1| 1320|Homo sapiens myopalladin protein. 33 0.87 X61656-1|CAA43837.1| 1354|Homo sapiens membrane protein protein. 32 1.2 L04947-1|AAA59459.1| 1354|Homo sapiens receptor tyrosine kinase ... 32 1.2 BC131822-1|AAI31823.1| 1356|Homo sapiens kinase insert domain re... 32 1.2 AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. 32 1.2 AF063658-1|AAC16450.1| 1356|Homo sapiens vascular endothelial gr... 32 1.2 AF035121-1|AAB88005.1| 1356|Homo sapiens KDR/flk-1 protein protein. 32 1.2 AB209901-1|BAD93138.1| 1451|Homo sapiens kinase insert domain re... 32 1.2 X69089-1|CAA48832.1| 1465|Homo sapiens 165kD protein protein. 32 1.5 BC052969-1|AAH52969.1| 1465|Homo sapiens myomesin (M-protein) 2,... 32 1.5 AJ306906-1|CAC37630.1| 2673|Homo sapiens fibulin-6 protein. 32 1.5 M97675-1|AAA60275.1| 937|Homo sapiens transmembrane receptor pr... 31 2.0 BC142609-1|AAI42610.1| 658|Homo sapiens MYPN protein protein. 31 2.0 BC128386-1|AAI28387.1| 940|Homo sapiens ROR1 protein protein. 31 2.0 BC080541-1|AAH80541.1| 393|Homo sapiens ROR1 protein protein. 31 2.0 AY044449-1|AAK95951.1| 1907|Homo sapiens muscle alpha-kinase pro... 31 2.0 AM231061-1|CAJ76912.1| 1960|Homo sapiens obscurin isoform B prot... 31 2.0 AL670729-4|CAH71670.2| 2582|Homo sapiens obscurin, cytoskeletal ... 31 2.0 AL445205-2|CAH71706.1| 937|Homo sapiens receptor tyrosine kinas... 31 2.0 AL445205-1|CAH71705.1| 393|Homo sapiens receptor tyrosine kinas... 31 2.0 AL353593-4|CAM27610.1| 2582|Homo sapiens obscurin, cytoskeletal ... 31 2.0 AL161742-2|CAI21932.1| 937|Homo sapiens receptor tyrosine kinas... 31 2.0 AL161742-1|CAI21931.1| 393|Homo sapiens receptor tyrosine kinas... 31 2.0 AL137859-2|CAI21732.1| 937|Homo sapiens receptor tyrosine kinas... 31 2.0 AL137859-1|CAC17591.2| 393|Homo sapiens receptor tyrosine kinas... 31 2.0 AK027343-1|BAB55048.1| 507|Homo sapiens .117). protein. 31 2.0 AJ277892-5|CAD12459.1| 2154|Homo sapiens Titin Novex-1 Isoform p... 31 2.0 AF058332-2|AAD22604.1| 926|Homo sapiens myocardium-specific tit... 31 2.0 AF058332-1|AAD22603.1| 1019|Homo sapiens titin protein. 31 2.0 AB046859-1|BAB13465.2| 2584|Homo sapiens KIAA1639 protein protein. 31 2.0 M63696-1|AAA52177.1| 51|Homo sapiens DCC protein. 31 2.7 M32288-1|AAA52175.1| 53|Homo sapiens colorectal tumor suppress... 31 2.7 BC115378-1|AAI15379.1| 875|Homo sapiens coiled-coil domain cont... 31 2.7 AK129847-1|BAC85242.1| 875|Homo sapiens protein ( Homo sapiens ... 31 2.7 X73113-1|CAA51544.1| 1142|Homo sapiens fast MyBP-C protein. 31 3.5 X69490-1|CAA49245.1| 4650|Homo sapiens titin protein. 31 3.5 X64697-1|CAA45938.1| 3100|Homo sapiens titin protein. 31 3.5 BX537998-1|CAD97954.1| 1263|Homo sapiens hypothetical protein pr... 31 3.5 BC130536-1|AAI30537.1| 1141|Homo sapiens myosin binding protein ... 31 3.5 AY603755-1|AAT80901.1| 3094|Homo sapiens striated muscle prefere... 31 3.5 AY341951-1|AAQ76864.1| 85|Homo sapiens F379 retina specific pr... 31 3.5 AL670729-3|CAH71673.1| 6620|Homo sapiens obscurin, cytoskeletal ... 31 3.5 AL359510-13|CAI15072.1| 6620|Homo sapiens obscurin, cytoskeletal... 31 3.5 AL353593-3|CAI19285.1| 6620|Homo sapiens obscurin, cytoskeletal ... 31 3.5 AK092284-1|BAC03850.1| 885|Homo sapiens protein ( Homo sapiens ... 31 3.5 AJ314908-1|CAC85755.1| 1020|Homo sapiens obscurin protein. 31 3.5 AJ277892-4|CAD12458.1| 1294|Homo sapiens Titin Novex-2 Isoform p... 31 3.5 AJ002535-1|CAC44768.1| 6620|Homo sapiens obscurin protein. 31 3.5 AF109126-1|AAD43217.1| 398|Homo sapiens stromal cell-derived re... 31 3.5 AB209812-1|BAD93049.1| 391|Homo sapiens stromal cell derived fa... 31 3.5 AB037718-1|BAA92535.1| 2242|Homo sapiens KIAA1297 protein protein. 31 3.5 M21616-1|AAA36427.1| 1106|Homo sapiens platelet-derived growth f... 30 4.6 J03278-1|AAA60049.1| 1106|Homo sapiens platelet-derived growth f... 30 4.6 DQ464902-1|ABE97925.1| 675|Homo sapiens nexilin protein. 30 4.6 BC114445-1|AAI14446.1| 567|Homo sapiens NEXN protein protein. 30 4.6 BC114444-1|AAI14445.1| 567|Homo sapiens NEXN protein protein. 30 4.6 BC111395-1|AAI11396.1| 554|Homo sapiens NEXN protein protein. 30 4.6 BC032224-1|AAH32224.1| 1106|Homo sapiens platelet-derived growth... 30 4.6 AK130921-1|BAC85460.1| 572|Homo sapiens protein ( Homo sapiens ... 30 4.6 AK057954-1|BAB71622.1| 505|Homo sapiens protein ( Homo sapiens ... 30 4.6 AK056557-1|BAB71216.1| 1252|Homo sapiens protein ( Homo sapiens ... 30 4.6 AF114264-1|AAD29607.1| 448|Homo sapiens unknown protein. 30 4.6 BC039266-1|AAH39266.1| 367|Homo sapiens DMRT-like family C2 pro... 30 6.1 BC029202-1|AAH29202.1| 367|Homo sapiens DMRT-like family C2 pro... 30 6.1 AJ291669-1|CAC40652.1| 333|Homo sapiens Doublesex-mab-3 (DM) do... 30 6.1 Y18265-1|CAB41400.1| 1324|Homo sapiens zinc finger protein SALL1... 29 8.1 Y18264-1|CAB41399.1| 1324|Homo sapiens zinc finger protein SALL1... 29 8.1 X73114-1|CAA51545.1| 1123|Homo sapiens slow MyBP-C protein. 29 8.1 X66276-1|CAA46987.1| 1138|Homo sapiens C protein protein. 29 8.1 BC117217-1|AAI17218.1| 1120|Homo sapiens MYBPC1 protein protein. 29 8.1 BC092418-1|AAH92418.1| 1123|Homo sapiens myosin binding protein ... 29 8.1 >X90568-1|CAA62188.1|26926|Homo sapiens titin protein. Length = 26926 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 + L++VT +E + V SG PSPT+ W+++DY+ Sbjct: 900 VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 936 Score = 38.3 bits (85), Expect = 0.018 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 S A SGF R+++ LE V F+ SG P P IAW+KD Sbjct: 1240 SEAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1281 Score = 36.3 bits (80), Expect = 0.071 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 +DGGAP++GY VE + EW PP L+ Sbjct: 18531 YDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQ 18562 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 134 IKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPP 238 + G +DGG+P+ GY VE R S W+R P Sbjct: 13110 LSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLP 13144 Score = 34.7 bits (76), Expect = 0.22 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIRTAPP 238 DGG+P++GY VE G+T+W R P Sbjct: 9234 DGGSPIKGYIVEMQEEGTTDWKRVNEP 9260 Score = 34.7 bits (76), Expect = 0.22 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VEC + G+ +W R Sbjct: 11333 DGGSPILGYVVECQKPGTAQWNR 11355 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTA 232 HDGGA + Y +E + G+ EW+R A Sbjct: 7512 HDGGAKIESYVIEMLKTGTDEWVRVA 7537 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 D+ +E +K+ V F +P PT++W KD E Sbjct: 7898 DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 7929 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 Score = 32.7 bits (71), Expect = 0.87 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEW 220 HDGG+ + GY +E R GS +W Sbjct: 14493 HDGGSKITGYVIEAQRKGSDQW 14514 Score = 32.3 bits (70), Expect = 1.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++L++V E ++E V +G P+P I W K+ Sbjct: 1512 FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKN 1546 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 HDGG+ + GY VE ++G EW R Sbjct: 10641 HDGGSKILGYIVEYQKVGDEEWRR 10664 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 3577 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 3612 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 433 DKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL 531 D++ + SG P PTI W KD EN++V E + Sbjct: 8198 DEIALDASISGSPYPTITWIKD--ENVIVPEEI 8228 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +DGG P+ Y VE + ST W+ A ++ Sbjct: 14688 NDGGVPISNYVVEMRQTDSTTWVELATTVI 14717 Score = 31.1 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VE G+ +WI+ Sbjct: 10939 DGGSPITGYLVEYQEEGTQDWIK 10961 Score = 31.1 bits (67), Expect = 2.7 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR--TAP 235 HDGG+ + GY VE +L +W+R TAP Sbjct: 12718 HDGGSKIIGYFVEACKLPGDKWVRCNTAP 12746 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 143 GATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 G +DGG + GY VE ++G WI+ LR Sbjct: 14197 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14232 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEW 220 DGGAP+ GY VE + T+W Sbjct: 19613 DGGAPITGYTVEYKKSDDTDW 19633 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L + E V F + SGIP PT+ W KD Sbjct: 25300 FKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 25334 Score = 30.3 bits (65), Expect = 4.6 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF E Sbjct: 2748 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVE 2787 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 439 VEFYVTFSGIPSPTIAWFKDDYE 507 V+ SG P+PTI W+KDD E Sbjct: 20393 VKLRAGISGKPAPTIEWYKDDKE 20415 Score = 29.9 bits (64), Expect = 6.1 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 3196 LQELQPVTVQSGKPARFCAMISGRPQPKISWYKEE 3230 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 3448 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 3491 Score = 29.9 bits (64), Expect = 6.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 131 YIKMGATTHDGGAPLRGYQVECNRLGSTEWIR 226 Y+K +DGG+P Y VE GS +W R Sbjct: 11621 YLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 11652 Score = 29.9 bits (64), Expect = 6.1 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 122 ECNYIKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +C ++ DGG+P+ GY +E S W++ +V Sbjct: 12609 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLV 12649 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 +K L +T K+E T +G P P I W K D Sbjct: 7197 VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKAD 7231 >AJ277892-3|CAD12457.1| 5604|Homo sapiens Novex-3 Titin Isoform protein. Length = 5604 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 + L++VT +E + V SG PSPT+ W+++DY+ Sbjct: 946 VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982 Score = 38.3 bits (85), Expect = 0.018 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 S A SGF R+++ LE V F+ SG P P IAW+KD Sbjct: 1286 SEAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 Score = 33.1 bits (72), Expect = 0.66 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++ +E E D F F G P P + W+ +D Sbjct: 3946 FLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNND 3981 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++L++V E ++E V +G P+P I W K+ Sbjct: 1558 FVEKLKNVNIKEGSQLEMKVRATGNPNPDIVWLKN 1592 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF + E Sbjct: 2794 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKNVE 2833 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 376 VAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 V G FIK + D A F G P PT+ W+KD Sbjct: 5510 VEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 5550 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 3242 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 3276 >AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. Length = 30000 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 + L++VT +E + V SG PSPT+ W+++DY+ Sbjct: 946 VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982 Score = 38.3 bits (85), Expect = 0.018 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 S A SGF R+++ LE V F+ SG P P IAW+KD Sbjct: 1286 SEAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327 Score = 36.3 bits (80), Expect = 0.071 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 +DGGAP++GY VE + EW PP L+ Sbjct: 25955 YDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQ 25986 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 134 IKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPP 238 + G +DGG+P+ GY VE R S W+R P Sbjct: 20534 LSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLP 20568 Score = 34.7 bits (76), Expect = 0.22 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIRTAPP 238 DGG+P++GY VE G+T+W R P Sbjct: 16658 DGGSPIKGYIVEMQEEGTTDWKRVNEP 16684 Score = 34.7 bits (76), Expect = 0.22 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VEC + G+ +W R Sbjct: 18757 DGGSPILGYVVECQKPGTAQWNR 18779 Score = 34.3 bits (75), Expect = 0.29 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 FIK++E+ T + F T +G P +I W KDD Sbjct: 5977 FIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDD 6012 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 F+KRL D + + T++G P +++W KD+Y Sbjct: 7856 FVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEY 7892 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTA 232 HDGGA + Y +E + G+ EW+R A Sbjct: 14936 HDGGAKIESYVIEMLKTGTDEWVRVA 14961 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 D+ +E +K+ V F +P PT++W KD E Sbjct: 15322 DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 15353 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 Score = 33.1 bits (72), Expect = 0.66 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+K+L D++ + +V+ T G ++ WFKD E Sbjct: 8421 FVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGE 8458 Score = 32.7 bits (71), Expect = 0.87 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEW 220 HDGG+ + GY +E R GS +W Sbjct: 21917 HDGGSKITGYVIEAQRKGSDQW 21938 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++L++V E ++E V +G P+P I W K+ Sbjct: 1558 FVEKLKNVNIKEGSQLEMKVRATGNPNPDIVWLKN 1592 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 HDGG+ + GY VE ++G EW R Sbjct: 18065 HDGGSKILGYIVEYQKVGDEEWRR 18088 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 3623 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 3658 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 433 DKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL 531 D++ + SG P PTI W KD EN++V E + Sbjct: 15622 DEIALDASISGSPYPTITWIKD--ENVIVPEEI 15652 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +DGG P+ Y VE + ST W+ A ++ Sbjct: 22112 NDGGVPISNYVVEMRQTDSTTWVELATTVI 22141 Score = 31.1 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VE G+ +WI+ Sbjct: 18363 DGGSPITGYLVEYQEEGTQDWIK 18385 Score = 31.1 bits (67), Expect = 2.7 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR--TAP 235 HDGG+ + GY VE +L +W+R TAP Sbjct: 20142 HDGGSKIIGYFVEACKLPGDKWVRCNTAP 20170 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF + E Sbjct: 2794 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKNVE 2833 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 FIK++E ++L F T G T+ W KD E Sbjct: 5415 FIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDE 5452 Score = 30.7 bits (66), Expect = 3.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+ LE + A D V +G P T++W+K D Sbjct: 7008 FVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGD 7043 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 143 GATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 G +DGG + GY VE ++G WI+ LR Sbjct: 21621 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 21656 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEW 220 DGGAP+ GY VE + T+W Sbjct: 27037 DGGAPITGYTVEYKKSDDTDW 27057 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 3242 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 3276 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 421 ALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVG 522 A+ + VEF G P I WFKDD E LV G Sbjct: 6268 AIPDSTVEFKAILKGTPPFKIKWFKDDVE-LVSG 6300 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+K+L D + L D VE G ++ W KD Sbjct: 7480 FVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKD 7514 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 439 VEFYVTFSGIPSPTIAWFKDDYE 507 V+ SG P+PTI W+KDD E Sbjct: 27817 VKLRAGISGKPAPTIEWYKDDKE 27839 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 3494 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 3537 Score = 29.9 bits (64), Expect = 6.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 131 YIKMGATTHDGGAPLRGYQVECNRLGSTEWIR 226 Y+K +DGG+P Y VE GS +W R Sbjct: 19045 YLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 19076 Score = 29.9 bits (64), Expect = 6.1 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 122 ECNYIKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +C ++ DGG+P+ GY +E S W++ +V Sbjct: 20033 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLV 20073 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 +K L +T K+E T +G P P I W K D Sbjct: 14621 VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKAD 14655 >AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. Length = 26926 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 + L++VT +E + V SG PSPT+ W+++DY+ Sbjct: 900 VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 936 Score = 38.3 bits (85), Expect = 0.018 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 S A SGF R+++ LE V F+ SG P P IAW+KD Sbjct: 1240 SEAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1281 Score = 36.3 bits (80), Expect = 0.071 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 +DGGAP++GY VE + EW PP L+ Sbjct: 18531 YDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQ 18562 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 134 IKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPP 238 + G +DGG+P+ GY VE R S W+R P Sbjct: 13110 LSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLP 13144 Score = 34.7 bits (76), Expect = 0.22 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIRTAPP 238 DGG+P++GY VE G+T+W R P Sbjct: 9234 DGGSPIKGYIVEMQEEGTTDWKRVNEP 9260 Score = 34.7 bits (76), Expect = 0.22 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VEC + G+ +W R Sbjct: 11333 DGGSPILGYVVECQKPGTAQWNR 11355 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTA 232 HDGGA + Y +E + G+ EW+R A Sbjct: 7512 HDGGAKIESYVIEMLKTGTDEWVRVA 7537 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 D+ +E +K+ V F +P PT++W KD E Sbjct: 7898 DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 7929 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 Score = 32.7 bits (71), Expect = 0.87 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEW 220 HDGG+ + GY +E R GS +W Sbjct: 14493 HDGGSKITGYVIEAQRKGSDQW 14514 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++L++V E ++E V +G P+P I W K+ Sbjct: 1512 FVEKLKNVNIKEGSQLEMKVRATGNPNPDIVWLKN 1546 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 HDGG+ + GY VE ++G EW R Sbjct: 10641 HDGGSKILGYIVEYQKVGDEEWRR 10664 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 3577 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 3612 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 433 DKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL 531 D++ + SG P PTI W KD EN++V E + Sbjct: 8198 DEIALDASISGSPYPTITWIKD--ENVIVPEEI 8228 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +DGG P+ Y VE + ST W+ A ++ Sbjct: 14688 NDGGVPISNYVVEMRQTDSTTWVELATTVI 14717 Score = 31.1 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEWIR 226 DGG+P+ GY VE G+ +WI+ Sbjct: 10939 DGGSPITGYLVEYQEEGTQDWIK 10961 Score = 31.1 bits (67), Expect = 2.7 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR--TAP 235 HDGG+ + GY VE +L +W+R TAP Sbjct: 12718 HDGGSKIIGYFVEACKLPGDKWVRCNTAP 12746 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF + E Sbjct: 2748 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKNVE 2787 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 143 GATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIVLR 250 G +DGG + GY VE ++G WI+ LR Sbjct: 14197 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14232 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 158 DGGAPLRGYQVECNRLGSTEW 220 DGGAP+ GY VE + T+W Sbjct: 19613 DGGAPITGYTVEYKKSDDTDW 19633 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L + E V F + SGIP PT+ W KD Sbjct: 25300 FKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 25334 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 3196 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 3230 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 439 VEFYVTFSGIPSPTIAWFKDDYE 507 V+ SG P+PTI W+KDD E Sbjct: 20393 VKLRAGISGKPAPTIEWYKDDKE 20415 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 3448 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 3491 Score = 29.9 bits (64), Expect = 6.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 131 YIKMGATTHDGGAPLRGYQVECNRLGSTEWIR 226 Y+K +DGG+P Y VE GS +W R Sbjct: 11621 YLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 11652 Score = 29.9 bits (64), Expect = 6.1 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 122 ECNYIKMGATTHDGGAPLRGYQVECNRLGSTEWIRTAPPIV 244 +C ++ DGG+P+ GY +E S W++ +V Sbjct: 12609 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLV 12649 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 +K L +T K+E T +G P P I W K D Sbjct: 7197 VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKAD 7231 >AC023270-1|AAX88844.1| 5604|Homo sapiens unknown protein. Length = 5604 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 + L++VT +E + V SG PSPT+ W+++DY+ Sbjct: 946 VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982 Score = 39.1 bits (87), Expect = 0.010 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 S A SGF R+++ LE V F+ SG P P IAW+KD Sbjct: 1286 SEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 Score = 33.1 bits (72), Expect = 0.66 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++ +E E D F F G P P + W+ +D Sbjct: 3946 FLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNND 3981 Score = 32.3 bits (70), Expect = 1.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++L++V E ++E V +G P+P I W K+ Sbjct: 1558 FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKN 1592 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 376 VAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 V G FIK + D A F G P PT+ W+KD Sbjct: 5510 VEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 5550 Score = 30.3 bits (65), Expect = 4.6 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF E Sbjct: 2794 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVE 2833 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 3242 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 3276 >X90870-1|CAA62378.1| 458|Homo sapiens myosin-light-chain kinase protein. Length = 458 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 355 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 390 >X85337-1|CAA59685.1| 991|Homo sapiens myosin light chain kinase protein. Length = 991 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 888 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 923 >U48959-1|AAC18423.2| 1914|Homo sapiens myosin light chain kinase protein. Length = 1914 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1811 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1846 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 427 ENDKVEFYVTFSGIPSPTIAWF 492 EN V+F SGIP P +AWF Sbjct: 427 ENQTVKFRCEVSGIPKPEVAWF 448 >DQ533874-1|ABF83431.1| 1378|Homo sapiens ROBO2 isoform b protein. Length = 1378 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++R + LE + VEF G P PT+ W KDD Sbjct: 227 FLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDD 262 >DQ533873-1|ABF83430.1| 1394|Homo sapiens ROBO2 isoform a protein. Length = 1394 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++R + LE + VEF G P PT+ W KDD Sbjct: 243 FLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDD 278 >BC146772-1|AAI46773.1| 1378|Homo sapiens roundabout, axon guidance receptor, homolog 2 (Drosophila) protein. Length = 1378 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++R + LE + VEF G P PT+ W KDD Sbjct: 227 FLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDD 262 >BC113458-1|AAI13459.1| 166|Homo sapiens MYLK protein protein. Length = 166 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 63 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 98 >BC113456-1|AAI13457.1| 167|Homo sapiens MYLK protein protein. Length = 167 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 64 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 99 >BC107783-1|AAI07784.1| 227|Homo sapiens MYLK protein protein. Length = 227 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 124 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 159 >BC100763-1|AAI00764.2| 153|Homo sapiens myosin, light chain kinase protein. Length = 153 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 50 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 85 >BC100762-1|AAI00763.2| 154|Homo sapiens myosin, light chain kinase protein. Length = 154 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 51 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 86 >BC100761-1|AAI00762.2| 154|Homo sapiens myosin, light chain kinase protein. Length = 154 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 51 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 86 >BC064420-1|AAH64420.2| 153|Homo sapiens myosin, light chain kinase protein. Length = 153 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 50 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 85 >BC017811-1|AAH17811.1| 236|Homo sapiens MYLK protein protein. Length = 236 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 123 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 158 >AY424270-1|AAR29062.1| 1914|Homo sapiens myosin lignt chain polypeptide kinase isoform 1 protein. Length = 1914 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1811 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1846 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 427 ENDKVEFYVTFSGIPSPTIAWF 492 EN V+F SGIP P +AWF Sbjct: 427 ENQTVKFRCEVSGIPKPEVAWF 448 >AY424269-1|AAR29061.1| 1845|Homo sapiens myosin light chain polypeptide kinase isoform 2 protein. Length = 1845 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1742 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1777 >AY339601-1|AAQ02673.1| 1914|Homo sapiens long myosin light chain kinase protein. Length = 1914 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1811 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1846 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 427 ENDKVEFYVTFSGIPSPTIAWF 492 EN V+F SGIP P +AWF Sbjct: 427 ENQTVKFRCEVSGIPKPEVAWF 448 >AF096775-1|AAD54019.1| 154|Homo sapiens kinase-related protein isoform 2 protein. Length = 154 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 51 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 86 >AF096774-1|AAD54018.1| 153|Homo sapiens kinase-related protein isoform 1 protein. Length = 153 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 50 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 85 >AF096773-1|AAD54017.1| 154|Homo sapiens kinase-related protein protein. Length = 154 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 51 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 86 >AF096771-2|AAD51381.1| 153|Homo sapiens kinase related protein protein. Length = 153 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 50 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 85 >AF096771-1|AAD51380.1| 300|Homo sapiens smooth muscle/nonmuscle myosin light chain kinase protein. Length = 300 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 197 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 232 >AF069604-1|AAD15924.1| 560|Homo sapiens myosin light chain kinase isoform 4 protein. Length = 560 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 457 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 492 >AF069603-1|AAD15923.1| 1793|Homo sapiens myosin light chain kinase isoform 3B protein. Length = 1793 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1690 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1725 >AF069602-1|AAD15922.1| 1862|Homo sapiens myosin light chain kinase isoform 3A protein. Length = 1862 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1759 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1794 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 427 ENDKVEFYVTFSGIPSPTIAWF 492 EN V+F SGIP P +AWF Sbjct: 427 ENQTVKFRCEVSGIPKPEVAWF 448 >AF069601-1|AAD15921.2| 1845|Homo sapiens myosin light chain kinase isoform 2 protein. Length = 1845 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 1742 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1777 >AB046788-1|BAB13394.1| 1380|Homo sapiens KIAA1568 protein protein. Length = 1380 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F++R + LE + VEF G P PT+ W KDD Sbjct: 229 FLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDD 264 >AB037663-1|BAB21504.1| 992|Homo sapiens myosin light chain kinase protein. Length = 992 Score = 35.1 bits (77), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F K + D+ +E F G P P + WFKDD Sbjct: 889 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 924 >X90569-1|CAA62189.1| 7962|Homo sapiens elastic titin protein. Length = 7962 Score = 34.3 bits (75), Expect = 0.29 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 FIK++E+ T + F T +G P +I W KDD Sbjct: 1715 FIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDD 1750 Score = 34.3 bits (75), Expect = 0.29 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 F+KRL D + + T++G P +++W KD+Y Sbjct: 3594 FVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEY 3630 Score = 33.1 bits (72), Expect = 0.66 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+K+L D++ + +V+ T G ++ WFKD E Sbjct: 4159 FVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGE 4196 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 FIK++E ++L F T G T+ W KD E Sbjct: 1153 FIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDE 1190 Score = 30.7 bits (66), Expect = 3.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+ LE + A D V +G P T++W+K D Sbjct: 2746 FVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGD 2781 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 421 ALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVG 522 A+ + VEF G P I WFKDD E LV G Sbjct: 2006 AIPDSTVEFKAILKGTPPFKIKWFKDDVE-LVSG 2038 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+K+L D + L D VE G ++ W KD Sbjct: 3218 FVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKD 3252 >BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA sequence from clone RP11-465I11 on chromosome 1 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >BC115397-1|AAI15398.1| 867|Homo sapiens IGSF22 protein protein. Length = 867 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 134 IKMGATTHDGGAPLRGYQVECNRLGSTEWI 223 I A T DGGAP+ GY VE + GS W+ Sbjct: 820 ITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849 Score = 31.5 bits (68), Expect = 2.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+++ + VTA E DK F G P P I+W ++ Sbjct: 69 FVEKPQPVTAPEGDKAVFRARVQGNPKPHISWKRE 103 >BC115022-1|AAI15023.1| 1551|Homo sapiens ROBO1 protein protein. Length = 1551 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+KR ++ +D EF G P PT+ W KDD E Sbjct: 225 FVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGE 262 >BC115020-1|AAI15021.1| 1606|Homo sapiens ROBO1 protein protein. Length = 1606 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+KR ++ +D EF G P PT+ W KDD E Sbjct: 225 FVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGE 262 >BC112336-1|AAI12337.1| 1607|Homo sapiens ROBO1 protein protein. Length = 1607 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+KR ++ +D EF G P PT+ W KDD E Sbjct: 225 FVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGE 262 >AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-268N14 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-77J13 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-164L12 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-174L6 on chromosome 1 Contains the3' end of the gene for hemicentin, the PRG4 gene for proteoglycan 4 ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-153O3 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-118G19 on chromosome 1q25.1-31.1 Contains the 5' end of the gene for hemicentin. ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-248A21 on chromosome 1q31.1-31.3 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 34.3 bits (75), Expect = 0.29 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+I WFKD + Sbjct: 2394 ENISVVEKNSVSLTCEASGIPLPSITWFKDGW 2425 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3255 DVSVLLGENVELVCNANGIPTPLIQWLKD 3283 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3536 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3565 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AK095113-1|BAC04488.1| 903|Homo sapiens protein ( Homo sapiens cDNA FLJ37794 fis, clone BRHIP3000488. ). Length = 903 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 134 IKMGATTHDGGAPLRGYQVECNRLGSTEWI 223 I A T DGGAP+ GY VE + GS W+ Sbjct: 719 ITWNAPTQDGGAPVLGYIVERRKKGSNLWV 748 >AF040990-1|AAC39575.1| 1651|Homo sapiens roundabout 1 protein. Length = 1651 Score = 34.3 bits (75), Expect = 0.29 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F+KR ++ +D EF G P PT+ W KDD E Sbjct: 264 FVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGE 301 >AK096821-1|BAC04869.1| 405|Homo sapiens protein ( Homo sapiens cDNA FLJ39502 fis, clone PROST2017098. ). Length = 405 Score = 33.9 bits (74), Expect = 0.38 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFK 495 F + L +VT +E V V +G P PT+ W+K Sbjct: 286 FSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWYK 319 >AC023270-2|AAX88845.1| 405|Homo sapiens unknown protein. Length = 405 Score = 33.9 bits (74), Expect = 0.38 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFK 495 F + L +VT +E V V +G P PT+ W+K Sbjct: 286 FSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWYK 319 >BC070170-1|AAH70170.1| 637|Homo sapiens TTN protein protein. Length = 637 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 >BC058824-1|AAH58824.1| 558|Homo sapiens TTN protein protein. Length = 558 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 >BC013396-1|AAH13396.1| 305|Homo sapiens TTN protein protein. Length = 305 Score = 33.5 bits (73), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L+ V LE F SG P P ++WF+D Sbjct: 8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD 42 >BC117370-1|AAI17371.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 33.1 bits (72), Expect = 0.66 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 +V T FI+ LED T + G P+P + W KDD LV Sbjct: 691 TVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLV 738 >BC117368-1|AAI17369.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 33.1 bits (72), Expect = 0.66 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 +V T FI+ LED T + G P+P + W KDD LV Sbjct: 691 TVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLV 738 >AL357055-1|CAH73254.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 33.1 bits (72), Expect = 0.66 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 +V T FI+ LED T + G P+P + W KDD LV Sbjct: 691 TVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLV 738 >AB018349-1|BAA34526.2| 1073|Homo sapiens KIAA0806 protein protein. Length = 1073 Score = 33.1 bits (72), Expect = 0.66 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 +V T FI+ LED T + G P+P + W KDD LV Sbjct: 699 TVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLV 746 >X76132-1|CAA53735.1| 1447|Homo sapiens tumour suppressor protein. Length = 1447 Score = 32.7 bits (71), Expect = 0.87 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +VAG F+ + E VTA D V G P PTI W K+ + Sbjct: 135 AVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQD 179 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ A E+ +EF T SG P PT+ W K+ Sbjct: 333 FLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN 367 >X64698-1|CAA45939.1| 1100|Homo sapiens titin protein. Length = 1100 Score = 32.7 bits (71), Expect = 0.87 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEW 220 HDGG+ + GY +E R GS +W Sbjct: 897 HDGGSKITGYVIEAQRKGSDQW 918 >M32292-1|AAA35751.1| 750|Homo sapiens protein ( Human colorectal tumor suppressor mRNA (DCC), 5' end. ). Length = 750 Score = 32.7 bits (71), Expect = 0.87 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +VAG F+ + E VTA D V G P PTI W K+ + Sbjct: 135 AVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQD 179 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ A E+ +EF T SG P PT+ W K+ Sbjct: 333 FLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN 367 >BC036524-1|AAH36524.1| 772|Homo sapiens DCC protein protein. Length = 772 Score = 32.7 bits (71), Expect = 0.87 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 373 SVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +VAG F+ + E VTA D V G P PTI W K+ + Sbjct: 69 AVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQD 113 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ A E+ +EF T SG P PT+ W K+ Sbjct: 267 FLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN 301 >AL834247-1|CAD38923.2| 1391|Homo sapiens hypothetical protein protein. Length = 1391 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 1018 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 1052 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 508 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 542 >AL832379-1|CAD91155.1| 1045|Homo sapiens hypothetical protein protein. Length = 1045 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 672 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 706 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 162 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 196 >AL832002-1|CAD89906.1| 1320|Homo sapiens hypothetical protein protein. Length = 1320 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 947 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 981 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 437 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 471 >AL512429-2|CAH73748.1| 1320|Homo sapiens sarcomeric protein myopalladin, 145 kDa (MYOP) protein. Length = 1320 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 947 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 981 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 437 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 471 >AL512429-1|CAH73747.1| 1045|Homo sapiens sarcomeric protein myopalladin, 145 kDa (MYOP) protein. Length = 1045 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 672 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 706 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 162 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 196 >AF328296-1|AAK50625.1| 1320|Homo sapiens myopalladin protein. Length = 1320 Score = 32.7 bits (71), Expect = 0.87 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F KRL+ E V F GIP P + WFKD Sbjct: 947 FDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKD 981 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 437 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 471 >X61656-1|CAA43837.1| 1354|Homo sapiens membrane protein protein. Length = 1354 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 671 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 706 >L04947-1|AAA59459.1| 1354|Homo sapiens receptor tyrosine kinase protein. Length = 1354 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 671 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 706 >BC131822-1|AAI31823.1| 1356|Homo sapiens kinase insert domain receptor (a type III receptor tyrosine kinase) protein. Length = 1356 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 673 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 708 >AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. Length = 5636 Score = 32.3 bits (70), Expect = 1.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKDDY 504 E+++ +E + V SGIP P+ WFKD + Sbjct: 2395 ENISVVEKNSVSLTCEASGIPLPSTTWFKDGW 2426 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 3256 DVSVLLGENVELVCNANGIPTPLIQWLKD 3284 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 3537 EEISVIVNNPLELTCIASGIPAPKMTWMKD 3566 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 1365 EQVSNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 1400 >AF063658-1|AAC16450.1| 1356|Homo sapiens vascular endothelial growth factor receptor 2 protein. Length = 1356 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 673 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 708 >AF035121-1|AAB88005.1| 1356|Homo sapiens KDR/flk-1 protein protein. Length = 1356 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 673 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 708 >AB209901-1|BAD93138.1| 1451|Homo sapiens kinase insert domain receptor (a type III receptor tyrosine kinase) variant protein. Length = 1451 Score = 32.3 bits (70), Expect = 1.2 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLV 516 LE+ T + +E T SG P P I WFKD+ E LV Sbjct: 768 LENQTTSIGESIEVSCTASGNPPPQIMWFKDN-ETLV 803 >X69089-1|CAA48832.1| 1465|Homo sapiens 165kD protein protein. Length = 1465 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 364 FRSSVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F ++ + RL T E V+ T G P+P + W+KD Sbjct: 146 FEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKD 190 >BC052969-1|AAH52969.1| 1465|Homo sapiens myomesin (M-protein) 2, 165kDa protein. Length = 1465 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 364 FRSSVAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F ++ + RL T E V+ T G P+P + W+KD Sbjct: 146 FEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKD 190 >AJ306906-1|CAC37630.1| 2673|Homo sapiens fibulin-6 protein. Length = 2673 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 412 DVTALENDKVEFYVTFSGIPSPTIAWFKD 498 DV+ L + VE +GIP+P I W KD Sbjct: 293 DVSVLLGENVELVCNANGIPTPLIQWLKD 321 Score = 31.5 bits (68), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 409 EDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 E+++ + N+ +E SGIP+P + W KD Sbjct: 574 EEISVIVNNPLELTCIASGIPAPKMTWMKD 603 >M97675-1|AAA60275.1| 937|Homo sapiens transmembrane receptor protein. Length = 937 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >BC142609-1|AAI42610.1| 658|Homo sapiens MYPN protein protein. Length = 658 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 437 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 471 >BC128386-1|AAI28387.1| 940|Homo sapiens ROR1 protein protein. Length = 940 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 67 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 105 >BC080541-1|AAH80541.1| 393|Homo sapiens ROR1 protein protein. Length = 393 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AY044449-1|AAK95951.1| 1907|Homo sapiens muscle alpha-kinase protein. Length = 1907 Score = 31.5 bits (68), Expect = 2.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 F L+ + E+ V F +G P P + W+KDD E Sbjct: 281 FETTLKSRSVSEDSDVRFTCIVTGYPEPEVTWYKDDTE 318 >AM231061-1|CAJ76912.1| 1960|Homo sapiens obscurin isoform B protein. Length = 1960 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL*QQ 540 +EDV A +F G P P++ W+KD + LV L QQ Sbjct: 355 IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQ-LVDSTRLSQQ 398 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 8 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 42 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 102 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 136 >AL670729-4|CAH71670.2| 2582|Homo sapiens obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF protein. Length = 2582 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL*QQ 540 +EDV A +F G P P++ W+KD + LV L QQ Sbjct: 979 IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQ-LVDSTRLSQQ 1022 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 632 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 666 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 726 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 760 >AL445205-2|CAH71706.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AL445205-1|CAH71705.1| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AL353593-4|CAM27610.1| 2582|Homo sapiens obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF protein. Length = 2582 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL*QQ 540 +EDV A +F G P P++ W+KD + LV L QQ Sbjct: 979 IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQ-LVDSTRLSQQ 1022 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 632 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 666 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 726 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 760 >AL161742-2|CAI21932.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AL161742-1|CAI21931.1| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AL137859-2|CAI21732.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AL137859-1|CAC17591.2| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEP 528 + ++T E + SG P PTI WFK+D VV EP Sbjct: 64 MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAP--VVQEP 102 >AK027343-1|BAB55048.1| 507|Homo sapiens .117). protein. Length = 507 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F K L++++A E V F G PSP + W+++ Sbjct: 437 FTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYRE 471 >AJ277892-5|CAD12459.1| 2154|Homo sapiens Titin Novex-1 Isoform protein. Length = 2154 Score = 31.5 bits (68), Expect = 2.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 FI+ L + + V F+ SGIP P I WF Sbjct: 1023 FIQPLSSLRVHNGETVRFHARVSGIPKPEIQWF 1055 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 1304 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 1339 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF + E Sbjct: 350 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKNVE 389 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 798 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 832 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 1175 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 1218 >AF058332-2|AAD22604.1| 926|Homo sapiens myocardium-specific titin protein. Length = 926 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 169 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 204 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 40 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 83 >AF058332-1|AAD22603.1| 1019|Homo sapiens titin protein. Length = 1019 Score = 31.5 bits (68), Expect = 2.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 F+K L+ + + F T G P+PT+ WFK++ Sbjct: 169 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKEN 204 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 364 FRSSVAGTSG-FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F S GT FIK + + D VT GIP P I WF Sbjct: 40 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF 83 >AB046859-1|BAB13465.2| 2584|Homo sapiens KIAA1639 protein protein. Length = 2584 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYENLVVGEPL*QQ 540 +EDV A +F G P P++ W+KD + LV L QQ Sbjct: 979 IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQ-LVDSTRLSQQ 1022 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 632 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 666 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 726 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 760 >M63696-1|AAA52177.1| 51|Homo sapiens DCC protein. Length = 51 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ A E+ +EF T SG P PT+ W K+ Sbjct: 4 FLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN 38 >M32288-1|AAA52175.1| 53|Homo sapiens colorectal tumor suppressor protein. Length = 53 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ A E+ +EF T SG P PT+ W K+ Sbjct: 4 FLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN 38 >BC115378-1|AAI15379.1| 875|Homo sapiens coiled-coil domain containing 141 protein. Length = 875 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F + L +VT +E V V +G P PT+ W+ Sbjct: 836 FSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWW 868 >AK129847-1|BAC85242.1| 875|Homo sapiens protein ( Homo sapiens cDNA FLJ26337 fis, clone HRT02844. ). Length = 875 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 F + L +VT +E V V +G P PT+ W+ Sbjct: 836 FSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWW 868 >X73113-1|CAA51544.1| 1142|Homo sapiens fast MyBP-C protein. Length = 1142 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG P+ GY VE + GS W++ Sbjct: 665 YDGGKPVTGYLVERKKKGSQRWMK 688 >X69490-1|CAA49245.1| 4650|Homo sapiens titin protein. Length = 4650 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L + E V F + SGIP PT+ W KD Sbjct: 3024 FKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 3058 >X64697-1|CAA45938.1| 3100|Homo sapiens titin protein. Length = 3100 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L + E V F + SGIP PT+ W KD Sbjct: 3024 FKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 3058 >BX537998-1|CAD97954.1| 1263|Homo sapiens hypothetical protein protein. Length = 1263 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 376 VAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 V G FIK + D A F G P PT+ W+KD Sbjct: 1169 VEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 1209 >BC130536-1|AAI30537.1| 1141|Homo sapiens myosin binding protein C, fast type protein. Length = 1141 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG P+ GY VE + GS W++ Sbjct: 664 YDGGKPVTGYLVERKKKGSQRWMK 687 >AY603755-1|AAT80901.1| 3094|Homo sapiens striated muscle preferentially expressed protein protein. Length = 3094 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAW 489 F + LEDV LE F SG P P + W Sbjct: 937 FTRLLEDVEVLEGRAARFDCKISGTPPPVVTW 968 Score = 29.5 bits (63), Expect = 8.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 +EDV + F V G P P I W+KD+ Sbjct: 1362 MEDVEVGAGETARFAVVVEGKPLPDIMWYKDE 1393 >AY341951-1|AAQ76864.1| 85|Homo sapiens F379 retina specific protein protein. Length = 85 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 51 WKSAGRPAPPGKPQIIPILSDDEPNAITLKWAPRRTTEERLY 176 W + G+ P KP PI+ + N K+ TE RLY Sbjct: 43 WPTLGKFLNPSKPHFSPIIKGKDSNIFPAKFLSDALTELRLY 84 >AL670729-3|CAH71673.1| 6620|Homo sapiens obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF protein. Length = 6620 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 6016 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 6050 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 6110 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 6144 >AL359510-13|CAI15072.1| 6620|Homo sapiens obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF protein. Length = 6620 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 6016 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 6050 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 6110 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 6144 >AL353593-3|CAI19285.1| 6620|Homo sapiens obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF protein. Length = 6620 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 6016 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 6050 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 6110 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 6144 >AK092284-1|BAC03850.1| 885|Homo sapiens protein ( Homo sapiens cDNA FLJ34965 fis, clone NTONG2004308. ). Length = 885 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 376 VAGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 V G FIK + D A F G P PT+ W+KD Sbjct: 791 VEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 831 >AJ314908-1|CAC85755.1| 1020|Homo sapiens obscurin protein. Length = 1020 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 416 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 450 Score = 30.7 bits (66), Expect = 3.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 510 FVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKD 544 >AJ277892-4|CAD12458.1| 1294|Homo sapiens Titin Novex-2 Isoform protein. Length = 1294 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 385 TSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 T IK+ +DVTALEN V F V+ S P + WF + E Sbjct: 350 TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKNVE 389 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 397 IKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 ++ L+ VT F SG P P I+W+K++ Sbjct: 798 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEE 832 >AJ002535-1|CAC44768.1| 6620|Homo sapiens obscurin protein. Length = 6620 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F + L D TA + V+ +G P P I+W+KD Sbjct: 6016 FEEELADCTAELGETVKLACRVTGTPKPVISWYKD 6050 Score = 29.5 bits (63), Expect = 8.1 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAWFKD 498 F+ ++ +E + +F T G P P I W+KD Sbjct: 6110 FVNKVLASPFVEGEDAQFTCTIEGAPYPQIRWYKD 6144 >AF109126-1|AAD43217.1| 398|Homo sapiens stromal cell-derived receptor-1 beta protein. Length = 398 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 A +GF+K T L D E Y G P+P I W+ Sbjct: 28 AQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWW 65 >AB209812-1|BAD93049.1| 391|Homo sapiens stromal cell derived factor receptor 1 isoform b variant protein. Length = 391 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 A +GF+K T L D E Y G P+P I W+ Sbjct: 82 AQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWW 119 >AB037718-1|BAA92535.1| 2242|Homo sapiens KIAA1297 protein protein. Length = 2242 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 394 FIKRLEDVTALENDKVEFYVTFSGIPSPTIAW 489 F + LEDV LE F SG P P + W Sbjct: 85 FTRLLEDVEVLEGRAARFDCKISGTPPPVVTW 116 Score = 29.5 bits (63), Expect = 8.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 406 LEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 +EDV + F V G P P I W+KD+ Sbjct: 510 MEDVEVGAGETARFAVVVEGKPLPDIMWYKDE 541 >M21616-1|AAA36427.1| 1106|Homo sapiens platelet-derived growth factor receptor protein. Length = 1106 Score = 30.3 bits (65), Expect = 4.6 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +1 Query: 388 SGFIKRLEDVTALENDKVE----FYVTFSGIPSPTIAWFKDD 501 SG+++ L +V L+ ++ V F P PT+ WFKD+ Sbjct: 313 SGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDN 354 >J03278-1|AAA60049.1| 1106|Homo sapiens platelet-derived growth factor receptor protein. Length = 1106 Score = 30.3 bits (65), Expect = 4.6 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +1 Query: 388 SGFIKRLEDVTALENDKVE----FYVTFSGIPSPTIAWFKDD 501 SG+++ L +V L+ ++ V F P PT+ WFKD+ Sbjct: 313 SGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDN 354 >DQ464902-1|ABE97925.1| 675|Homo sapiens nexilin protein. Length = 675 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 579 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 616 >BC114445-1|AAI14446.1| 567|Homo sapiens NEXN protein protein. Length = 567 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 471 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 508 >BC114444-1|AAI14445.1| 567|Homo sapiens NEXN protein protein. Length = 567 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 471 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 508 >BC111395-1|AAI11396.1| 554|Homo sapiens NEXN protein protein. Length = 554 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 457 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 494 >BC032224-1|AAH32224.1| 1106|Homo sapiens platelet-derived growth factor receptor, beta polypeptide protein. Length = 1106 Score = 30.3 bits (65), Expect = 4.6 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +1 Query: 388 SGFIKRLEDVTALENDKVE----FYVTFSGIPSPTIAWFKDD 501 SG+++ L +V L+ ++ V F P PT+ WFKD+ Sbjct: 313 SGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDN 354 >AK130921-1|BAC85460.1| 572|Homo sapiens protein ( Homo sapiens cDNA FLJ27411 fis, clone WMC04903, highly similar to Myosin light chain kinase, smooth muscle and non-muscle isozymes ). Length = 572 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDD 501 K + D+ +E F G P P + W KDD Sbjct: 471 KTIRDLEVVEGSAARFDCKIEGYPDPEVVWSKDD 504 >AK057954-1|BAB71622.1| 505|Homo sapiens protein ( Homo sapiens cDNA FLJ25225 fis, clone STM00940, highly similar to Rattus norvegicus s-nexilin mRNA. ). Length = 505 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 409 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 446 >AK056557-1|BAB71216.1| 1252|Homo sapiens protein ( Homo sapiens cDNA FLJ31995 fis, clone NT2RP7009236, weakly similar to BASEMENT MEMBRANE-SPECIFIC HEPARAN SULFATE PROTEOGLYCAN CORE ). Length = 1252 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 400 KRLEDVTALENDKVEFYVTFSGIPSPTIAWFKDDYE 507 +++ +V+ L N + G PSP I W+KD+ + Sbjct: 436 EQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQ 471 >AF114264-1|AAD29607.1| 448|Homo sapiens unknown protein. Length = 448 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 379 AGTSGFIKRLEDVTALENDKVEFYVTFSGIPSPTIAWF 492 +G F K L++ + ++++ V F V +G P P I W+ Sbjct: 351 SGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWW 388 >BC039266-1|AAH39266.1| 367|Homo sapiens DMRT-like family C2 protein. Length = 367 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 69 PAPPGKPQIIPILSDDEPNAITLKWAP 149 P PPGK P+L P A L W P Sbjct: 144 PTPPGKNSCGPLLLSHPPEASPLSWTP 170 >BC029202-1|AAH29202.1| 367|Homo sapiens DMRT-like family C2 protein. Length = 367 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 69 PAPPGKPQIIPILSDDEPNAITLKWAP 149 P PPGK P+L P A L W P Sbjct: 144 PTPPGKNSCGPLLLSHPPEASPLSWTP 170 >AJ291669-1|CAC40652.1| 333|Homo sapiens Doublesex-mab-3 (DM) domain protein. Length = 333 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 69 PAPPGKPQIIPILSDDEPNAITLKWAP 149 P PPGK P+L P A L W P Sbjct: 110 PTPPGKNSCGPLLLSHPPEASPLSWTP 136 >Y18265-1|CAB41400.1| 1324|Homo sapiens zinc finger protein SALL1 protein. Length = 1324 Score = 29.5 bits (63), Expect = 8.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 57 SAGRPAPPGKPQIIPILSDDEPNAITL 137 S G P PP P +IP + +EP I + Sbjct: 554 SVGLPLPPSLPSLIPFIKTEEPAPIPI 580 >Y18264-1|CAB41399.1| 1324|Homo sapiens zinc finger protein SALL1 protein. Length = 1324 Score = 29.5 bits (63), Expect = 8.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 57 SAGRPAPPGKPQIIPILSDDEPNAITL 137 S G P PP P +IP + +EP I + Sbjct: 554 SVGLPLPPSLPSLIPFIKTEEPAPIPI 580 >X73114-1|CAA51545.1| 1123|Homo sapiens slow MyBP-C protein. Length = 1123 Score = 29.5 bits (63), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG+P+ GY +E + S+ W+R Sbjct: 645 YDGGSPILGYFIERKKKQSSRWMR 668 >X66276-1|CAA46987.1| 1138|Homo sapiens C protein protein. Length = 1138 Score = 29.5 bits (63), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG+P+ GY +E + S+ W+R Sbjct: 643 YDGGSPILGYFIERKKKQSSRWMR 666 >BC117217-1|AAI17218.1| 1120|Homo sapiens MYBPC1 protein protein. Length = 1120 Score = 29.5 bits (63), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG+P+ GY +E + S+ W+R Sbjct: 619 YDGGSPILGYFIERKKKQSSRWMR 642 >BC092418-1|AAH92418.1| 1123|Homo sapiens myosin binding protein C, slow type protein. Length = 1123 Score = 29.5 bits (63), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 155 HDGGAPLRGYQVECNRLGSTEWIR 226 +DGG+P+ GY +E + S+ W+R Sbjct: 645 YDGGSPILGYFIERKKKQSSRWMR 668 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,898,755 Number of Sequences: 237096 Number of extensions: 1505236 Number of successful extensions: 6346 Number of sequences better than 10.0: 137 Number of HSP's better than 10.0 without gapping: 4181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6337 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -