BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00305 (782 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0137 + 12667763-12667930,12668715-12668779,12668879-126689... 31 1.4 04_04_1264 - 32227812-32228114,32228199-32228349,32228454-322286... 28 9.6 >09_03_0137 + 12667763-12667930,12668715-12668779,12668879-12668954, 12669142-12669339,12669716-12669795,12670670-12670913, 12671061-12671162,12671243-12671305,12671550-12671627, 12671905-12671967,12672163-12672209,12672328-12672496 Length = 450 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -2 Query: 349 VVPQKENLVHVRALLLSVRELILHCVLEKPKIKLSNN 239 V +KEN V++ A+LL L+LH +L+ P + N+ Sbjct: 59 VYREKENHVNLYAVLLRFLRLLLHTILKHPDYRTDNS 95 >04_04_1264 - 32227812-32228114,32228199-32228349,32228454-32228691, 32228786-32228996,32229077-32229270,32229334-32229450, 32229580-32230522 Length = 718 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 146 HYQYERKKASYLSDIQITLYFCIIFTACIY 57 H ++KK YL + +T+ C++ CIY Sbjct: 316 HTSEDKKKNRYLVVVLVTIIPCLLMLTCIY 345 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,642,267 Number of Sequences: 37544 Number of extensions: 291568 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -