BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00302 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 1.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.6 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.5 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 6.0 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 6.0 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 6.0 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 7.9 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 7.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.9 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -1 Query: 462 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG 331 C +P S+ + L+ + + + Q NSP + P H+G Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 482 CSVRIGTAKHGLSIL*YKEFLARGARKVTTGITGL 586 CS IG H L KEF R +++ GI + Sbjct: 168 CSTPIGNLSHALLKDPVKEFWERRTLQISDGIENI 202 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 482 CSVRIGTAKHGLSIL*YKEFLARGARKVTTGITGL 586 CS IG H L KEF R +++ GI + Sbjct: 221 CSTPIGNLSHALLKDPVKEFWERRTLQISDGIENI 255 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 181 SSLKNHYFHCFITYSVGRK 237 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 160 VGDRFARSSLKNHYFHCFI 216 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 160 VGDRFARSSLKNHYFHCFI 216 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 188 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 78 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 299 TWRKRSSXFKTPA*SGSRTLPGGEFDWG 382 +WR S F +G + G F WG Sbjct: 227 SWRITHSYFMPDPLAGDYNIGGLNFQWG 254 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -1 Query: 237 LPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 91 +PP V K +V R+ E C ++ +QC + + FFP Sbjct: 97 MPPEEVV--IGKEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP 143 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 155 ATPLMSPYNARLESSSTGSSFP 90 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,659 Number of Sequences: 438 Number of extensions: 4254 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -