BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00298 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 6.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 6.3 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 6.3 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 6.3 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.3 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 685 VFLFFIPMLMVLRGYFSFSLT 747 VF+F IP+L+++ Y S +T Sbjct: 355 VFMFIIPLLILIGTYLSTFMT 375 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 685 VFLFFIPMLMVLRGYFSFSLT 747 VF+F IP+L+++ Y S +T Sbjct: 356 VFMFIIPLLILIGTYLSTFMT 376 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 218 LMRRMMRTPSTYL*IRAVQTTYFC 289 L RR MRT +T+ A++ T++C Sbjct: 243 LDRRCMRTGTTHHEADAIEQTFYC 266 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 218 LMRRMMRTPSTYL*IRAVQTTYFC 289 L RR MRT +T+ A++ T++C Sbjct: 243 LDRRCMRTGTTHHEADAIEQTFYC 266 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 676 TMRVFLFFIPMLMVLRGYFSFSLTCR*AHG 765 T +V L F P +RGYF FS+ ++G Sbjct: 1574 TGQVLLNFFPQKS-MRGYFDFSVLANDSYG 1602 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,161 Number of Sequences: 2352 Number of extensions: 18136 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -