BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00298 (805 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036233-1|AAH36233.1| 946|Homo sapiens WDR66 protein protein. 31 4.9 BC028421-1|AAH28421.1| 1154|Homo sapiens WD repeat domain 66 pro... 31 4.9 >BC036233-1|AAH36233.1| 946|Homo sapiens WDR66 protein protein. Length = 946 Score = 31.1 bits (67), Expect = 4.9 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 492 NSLTKHIINIWYNLSLFL*HSIPMTSFKSFNIIVG-ILESIYY 367 NS T+ I WY L HS P+ + K+FN +VG +SI++ Sbjct: 418 NSKTRAIYYAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFH 460 >BC028421-1|AAH28421.1| 1154|Homo sapiens WD repeat domain 66 protein. Length = 1154 Score = 31.1 bits (67), Expect = 4.9 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 492 NSLTKHIINIWYNLSLFL*HSIPMTSFKSFNIIVG-ILESIYY 367 NS T+ I WY L HS P+ + K+FN +VG +SI++ Sbjct: 418 NSKTRAIYYAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFH 460 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,797,813 Number of Sequences: 237096 Number of extensions: 2604384 Number of successful extensions: 12381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12381 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -