BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00296 (348 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 6.3 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 20 8.3 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 1.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 120 RRHKKNCQQK*RRKPMLFMNWQSK*GRNWL 209 RRH+KN + RR+ M ++++ S +W+ Sbjct: 261 RRHRKNLKDPCRRRQM-YVDFGSVGWNDWI 289 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 6.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 41 DIDATEHLEAFIADCDRRTTAAKQRLAETQEELSAEVTEK 160 D+D E+ + + DC++ + K+ A ELSA K Sbjct: 2439 DLD-WEYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPK 2477 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 19.8 bits (39), Expect = 8.3 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -3 Query: 301 RR*LSFCGVRQSLPLIDTLLDHTLFSECLSPSQFLPYLLCQFMN 170 RR LS + + + +D + +FSE L + P QF++ Sbjct: 124 RRNLSSLQIGEKIQALDPSTNELVFSEVLLFLDYNPSQKRQFLH 167 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,155 Number of Sequences: 336 Number of extensions: 1131 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -