BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00294 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) 70 9e-13 SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) 32 0.30 SB_8374| Best HMM Match : Cystatin (HMM E-Value=7.7) 30 0.92 SB_43872| Best HMM Match : DUF229 (HMM E-Value=0) 29 2.1 SB_53807| Best HMM Match : MCM (HMM E-Value=0) 27 6.5 SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_12978| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.8e-24) 27 8.6 SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) Length = 173 Score = 70.1 bits (164), Expect = 9e-13 Identities = 37/77 (48%), Positives = 43/77 (55%) Frame = +1 Query: 247 SFDLDKLWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIVXXXXXXX 426 S +LDK+W+LVSEQTR Y + DG VPVI++VKA PKQPVIV Sbjct: 97 SINLDKVWSLVSEQTRQNYKNKKDGPVPVIDVVKAGYYKVLGKGLLPKQPVIVKAKFFSR 156 Query: 427 XXXXXXXDVGGACVLSA 477 VGGACVL A Sbjct: 157 RAEDKIKAVGGACVLMA 173 Score = 34.7 bits (76), Expect = 0.043 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 158 RINMDKYHPGCFGKLGMRNFHFRKN 232 R + + HPG FGK+GMR+FH +N Sbjct: 67 RGSYEAIHPGYFGKVGMRHFHLTRN 91 >SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 240 Score = 31.9 bits (69), Expect = 0.30 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 242 RNSCSF*SGNFSYQVCQSIQDGTCPC*FCDGAHHQHYHDLLDAYGA 105 R+SC + F +C+S T PC D H +H DL+D GA Sbjct: 52 RSSCQ--ARCFMNNLCRSYNYNTTPCQLSDSDHLEHPSDLVDKPGA 95 >SB_8374| Best HMM Match : Cystatin (HMM E-Value=7.7) Length = 212 Score = 30.3 bits (65), Expect = 0.92 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 286 VQRLMSKAYLSQNWTEILVLSKVEISHTKFAKASRMVLVHVD 161 + R + A++ + W L V SH + KA+R L H++ Sbjct: 69 LNRTCADAHIDEQWCPCLTWIPVSTSHLQVVKAARKALAHIN 110 >SB_43872| Best HMM Match : DUF229 (HMM E-Value=0) Length = 806 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 286 VQRLMSKAYLSQNWTEILVLSKVEISHTKFAKASRMVLVHVD 161 + R + A++ + W L V SH + KA+R L H++ Sbjct: 502 LNRTCADAHIDEQWCPCLTWIPVSTSHLQVVKAARKALDHIN 543 >SB_53807| Best HMM Match : MCM (HMM E-Value=0) Length = 789 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 293 LVCSETNVQ-SLSKSKLDRNSCSF*SGNFSYQVCQSIQDGTCP 168 +V S T + LS K D CSF G F Q ++ G+CP Sbjct: 233 VVTSSTGIMPQLSVIKYDCPKCSFILGPFFQGSDQEVKPGSCP 275 >SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 497 ILLLIIYADSTQAPPTSLIFFSADFEKNF 411 I L+ YA+S P FFSADF+K F Sbjct: 291 ICLMFTYANSV-CNPVIYAFFSADFKKGF 318 >SB_12978| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.8e-24) Length = 1592 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 329 GTLPSGADAYFSLVCSETNVQSLSKSKLDR-NSCSF*SGNFSYQ 201 G P GA+ ++S + TN +SKS L + N F GN SY+ Sbjct: 1144 GKPPRGAEWFYSWLEDSTNDCRVSKSLLSQINYAVFGLGNSSYE 1187 >SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.1 bits (57), Expect = 8.6 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 166 HGQVPSWMLWQTWY 207 +G+ SW++W+TW+ Sbjct: 342 YGEFSSWLVWRTWF 355 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,587,119 Number of Sequences: 59808 Number of extensions: 286317 Number of successful extensions: 745 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -