BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00293 (772 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM748824-1|CAO72178.1| 512|Caenorhabditis elegans hexosaminidas... 28 8.5 AL033513-1|CAA22078.2| 512|Caenorhabditis elegans Hypothetical ... 28 8.5 >AM748824-1|CAO72178.1| 512|Caenorhabditis elegans hexosaminidase protein. Length = 512 Score = 27.9 bits (59), Expect = 8.5 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 11/87 (12%) Frame = -2 Query: 549 NEVINRIIFQLFVSFFKSW*SA*ISGFEKGSFFWNT--PF-------KLEGNKYKLLFTY 397 N++ + + + SF + W + G + S +WN P+ L+ KYK FT Sbjct: 259 NDLPSEMWKNMSYSFKEVWGGSAFKGADGASRYWNRLKPYILNNKEWYLQNEKYKPQFTT 318 Query: 396 IILFLAAGWSGF--IGDICSLRPKSCI 322 + GW + +C L P S + Sbjct: 319 FDSIIITGWQRYDHFASLCELWPTSMV 345 >AL033513-1|CAA22078.2| 512|Caenorhabditis elegans Hypothetical protein Y70D2A.2 protein. Length = 512 Score = 27.9 bits (59), Expect = 8.5 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 11/87 (12%) Frame = -2 Query: 549 NEVINRIIFQLFVSFFKSW*SA*ISGFEKGSFFWNT--PF-------KLEGNKYKLLFTY 397 N++ + + + SF + W + G + S +WN P+ L+ KYK FT Sbjct: 259 NDLPSEMWKNMSYSFKEVWGGSAFKGADGASRYWNRLKPYILNNKEWYLQNEKYKPQFTT 318 Query: 396 IILFLAAGWSGF--IGDICSLRPKSCI 322 + GW + +C L P S + Sbjct: 319 FDSIIITGWQRYDHFASLCELWPTSMV 345 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,397,894 Number of Sequences: 27780 Number of extensions: 335511 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -