BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00292 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.96 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 1.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 2.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.9 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 0.96 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S DTS+FR P+ Sbjct: 107 LSDKLESSDDTSLFRGPK 124 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.4 bits (48), Expect = 2.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 489 ERQEREKLNVS*---QRRLQKK*LQSRSWLRNFASRSYRKNQICD 614 E + +EK NV +++ +KK L LRN SY+ N CD Sbjct: 107 ECENKEKSNVCLKFEEQKRRKKSLDDVKILRNDRIDSYKSNLKCD 151 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 129 NYT*VLLLSRKRRLWRHLVSDKSLS 203 NY + L ++KR + H V+ KSLS Sbjct: 449 NYKSLNLAAQKREYYSHYVAFKSLS 473 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 244 YENFSPEHQNRTTIDSDLSLT 182 + N EH NRT D + LT Sbjct: 271 WRNLMDEHSNRTNSDPRMILT 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,172 Number of Sequences: 438 Number of extensions: 3567 Number of successful extensions: 33 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -