BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00288 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 28 0.091 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.6 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 3.4 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 4.5 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 7.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.9 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.9 bits (59), Expect = 0.091 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -3 Query: 386 SLLRGDTVDCESALNIID*TKQFISLLN*DNIHKSSRIS 270 SLL+ +TV C+ A++++ + +++ DNIH IS Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVIS 419 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 657 DVHNVEGAGMSLAGHDV 607 DVH V GAG + HDV Sbjct: 110 DVHGVIGAGHWIGDHDV 126 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 428 RSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 309 R G+ + T L+ ++L + CE +NI K ++SL Sbjct: 75 RYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSYLSL 114 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 451 RMMAAPSATQTHLSKSTIPSVRH 519 R++ PSA +T LSK S+ H Sbjct: 233 RLLDEPSANRTDLSKDDYESLVH 255 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 69 RSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPE 176 +S++ DV ++WR + E NR+ R++ + E Sbjct: 261 QSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTE 296 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 191 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 90 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/38 (28%), Positives = 14/38 (36%) Frame = -2 Query: 624 LAGHDVPTRPKLRPPVIIHKFPDSNLMKSIIFVVAMSN 511 L D P +P PP PDS + I + N Sbjct: 332 LGDSDTPPKPAPPPPPPSSSGPDSAKLDKIFDIATKEN 369 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 480 LGSGWCGHHALPSTEHS*VRSPH 412 +G G HA P HS +PH Sbjct: 419 MGHGHSHIHATPHHHHSHAATPH 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,962 Number of Sequences: 438 Number of extensions: 4260 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -