BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00285 (555 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20140.1 68418.m02397 SOUL heme-binding family protein contai... 29 1.6 At1g51550.1 68414.m05802 F-box family protein similar to F-box Z... 29 1.6 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 28 3.6 At2g46810.1 68415.m05841 basic helix-loop-helix (bHLH) family pr... 27 6.4 At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family... 27 6.4 At4g09080.1 68417.m01497 chloroplast outer membrane protein, put... 27 8.4 >At5g20140.1 68418.m02397 SOUL heme-binding family protein contains PFam profile PF04832: SOUL heme-binding protein Length = 378 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = -2 Query: 230 FYLVGRWLSIISFPPLLWDPHIIFLQLD------EDSVLCSHYE 117 + + RW ++ F PL W P ++F L E + CSH + Sbjct: 131 YEITTRWTMVMKFIPLPWKPELVFTGLSIMEVNPETNKFCSHLD 174 >At1g51550.1 68414.m05802 F-box family protein similar to F-box ZEITLUPE/FKF/LKP/ADAGIO proteins e.g. GI:13487068 from [Arabidopsis thaliana] Length = 478 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 17 KWKPRKISGTPAGKFG-SAIAIGSLLI 94 KWK K SGTP+G+FG + I IG L+ Sbjct: 165 KWKKVK-SGTPSGRFGHTCIVIGEYLL 190 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = -1 Query: 108 PHPAPINKLPIAIALPNFPA---GVPDI 34 P+P+P+ LPI LPN P VPD+ Sbjct: 193 PNPSPLPNLPIVPPLPNLPVPKLPVPDL 220 >At2g46810.1 68415.m05841 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 371 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 269 RSYPSLEHVSDHQFYLVGRWLSIISFPPLLWDPHIIFLQLDEDS 138 RS E V DHQ + + +S P LL D I FLQ+ + S Sbjct: 34 RSLQVQETVEDHQSFALEEEEQQLSTPSLLQDTTIPFLQMLQQS 77 >At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family protein similar to proline-rich cell wall protein [Gossypium barbadense] gi|451544|gb|AAA79364; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 124 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -1 Query: 108 PHPA-PIN--KLPIAIALPNFPAGVPDIFLGFHFDVSIP 1 P+PA PIN P I +PNFP +P+ F F+ SIP Sbjct: 77 PNPAQPINIPNFP-QINIPNFPISIPNNF-PFNLPTSIP 113 >At4g09080.1 68417.m01497 chloroplast outer membrane protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607 Length = 407 Score = 27.1 bits (57), Expect = 8.4 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +2 Query: 11 TSKWKPRKISGTPAGKFGSAIAIGSLLIGAGCGFYFHNASITQNLRRAAEKLYEDPIEEV 190 TS + RK+S G G + + +G C A+IT+NL R E Y EE+ Sbjct: 122 TSFFNSRKLSPVFTGGPGYEDLVPPMFVGRDC----LKATITENLTRQRELTYGVMFEEI 177 Query: 191 ERR 199 R Sbjct: 178 ITR 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,399,728 Number of Sequences: 28952 Number of extensions: 193452 Number of successful extensions: 432 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -