BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00283 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098997-1|AAC68718.1| 160|Caenorhabditis elegans Hypothetical ... 30 1.4 AF077539-2|AAK84579.2| 427|Caenorhabditis elegans Hypothetical ... 28 7.7 >AF098997-1|AAC68718.1| 160|Caenorhabditis elegans Hypothetical protein T10D4.7 protein. Length = 160 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -3 Query: 428 YIIPSNPGSSTTYTEYDLYQFLGILLYMS---VQKYPSKRSY 312 Y++P N +T T D++ F GI+ S + KYP+ SY Sbjct: 87 YLMPPNATPGSTPTGIDIFSFFGIICENSTWYITKYPNGYSY 128 >AF077539-2|AAK84579.2| 427|Caenorhabditis elegans Hypothetical protein T25D3.3 protein. Length = 427 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 195 PEHDRLFKIRIVIQQFNERFAT-VPMNQRLSVDEQMCSTKIGHFLNQY 55 P+ K+R + +Q E F VP++ RL + EQ+ + G F+NQ+ Sbjct: 145 PDTIEQVKVRRIEEQ--EGFVVRVPISDRLIIAEQLAKSTGGFFMNQF 190 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,963,433 Number of Sequences: 27780 Number of extensions: 260978 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -