BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00282 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 27 0.13 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 1.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.3 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 24 1.3 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 3.8 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.9 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 27.1 bits (57), Expect = 0.13 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 109 CRRRISCPDRTRDLRTNK*NK*KEFTCRLQSRTPIRSRCFSPRGTC 246 CR SC DR D N N K TC L+ + C GTC Sbjct: 115 CRNNGSCVDRIADFECNCKNGWKGKTCSLKDSHCDHTTC-KNGGTC 159 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +3 Query: 108 MPPTDFVPRPYTGPSYQQVEQMKGVYMPPSIT 203 +PP + P + P Y M V P++T Sbjct: 42 LPPITYPPSDWNCPQYNAPPYMSSVLQLPTVT 73 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -3 Query: 318 WPTETVTIPPNRSRYLLPSLSL-TTACAPG*EAP 220 WPT+ TIPP ++P + + C PG P Sbjct: 1079 WPTQGTTIPP--PAVVMPEVDKPSQPCEPGQYVP 1110 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +1 Query: 262 RRQEIPGSVRWNRHRLRGPLSSESKCSPQR 351 R+Q G + WN+ R +KC ++ Sbjct: 1127 RKQYCAGGLHWNKERKICDWPKSAKCEEKK 1156 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +3 Query: 108 MPPTDFVPRPYTGPSYQQVEQMKGVYMPPSIT 203 +PP + P + P Y M V P++T Sbjct: 33 LPPITYPPSDWNCPQYNAPPYMSSVLQLPTVT 64 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 3.8 Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +3 Query: 105 KMPPTDFVPRPYTGPSYQ-QVEQMKGVYMPPSITNA--YKKPVLLTQGHMQWLTTTTA 269 K+ P D P PY G ++ + + Y+ P+ A ++ + G M W +T+ Sbjct: 390 KVEPRDKAPSPYGGQMFEAPIPNVSPHYVTPTPPEAPLFQNVLPPIGGMMNWNMPSTS 447 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 103 AVLYVLTMSKHNFVPLLAISMC 38 AVLY + M H F +MC Sbjct: 483 AVLYTIHMGYHGFHNPFTCNMC 504 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 299 RFHRTDPGISCRRCR*PLHVPLG 231 RF T+PG C HV +G Sbjct: 591 RFKATNPGYWLFHCHIEFHVEVG 613 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,857 Number of Sequences: 336 Number of extensions: 4100 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -